SecReT4
Protein ID: 238892818
T4SS name [ID]Tfc [753]
Gene symbol-
Locus tagKP1_0629
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]618745..619452 [-]
Productputative type IV pilus protein
Component typeTfc2
UniProt IDC4X2J0
KEGG IDkpu:KP1_0629
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 235 a.a.     [Download]
>gi|238892818|ref|YP_002917552.1| putative type IV pilus protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MPSYPARSFQSTVEDAMKRLLPALILSIFNAVAAASPDAPEVVRYDRYLLVSPSPQQPPLEQLTALSIPP
GFHPTVGEALQYLLRGSGWSLCLADARRAQLYGLPLPLSQYHTGPLRLKAALQLLASPAWRMTTDENRRE
VCFTSDRSLPPTVAYRHPVSLRPLGPLTAPFFFAGTVQRGDIRLAVIVPPEAVYLHQVVWLRRGEQWHGW
RLERFDERRAVFRHGKRQLTLKVPE
 
Nucleotide Sequence: 708 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c619452-618745 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
TTGCCCTCTTATCCAGCACGCTCCTTTCAAAGCACTGTGGAGGATGCGATGAAACGACTGCTGCCAGCCC
TGATACTGTCCATTTTCAACGCCGTGGCCGCTGCCTCTCCAGACGCGCCAGAAGTCGTCCGCTACGACCG
CTATCTGCTGGTCAGCCCGTCACCGCAACAGCCGCCACTCGAACAGCTTACCGCCCTGTCCATTCCGCCC
GGTTTTCACCCGACGGTAGGGGAAGCGTTGCAGTACCTGCTGCGTGGCAGCGGCTGGTCCTTGTGTCTTG
CCGATGCGCGCCGGGCGCAGCTTTATGGCCTCCCGTTACCGTTGAGCCAGTACCACACCGGCCCGCTGCG
CCTGAAGGCCGCCCTGCAACTGCTGGCGAGCCCGGCATGGCGGATGACCACCGACGAAAACCGCCGTGAA
GTCTGTTTTACCAGCGACCGTTCCCTCCCCCCGACGGTGGCTTACCGTCATCCCGTGTCCCTCCGCCCTT
TGGGGCCGTTAACGGCCCCGTTTTTTTTCGCCGGGACCGTACAGCGCGGTGATATCCGCCTGGCAGTGAT
TGTGCCGCCCGAAGCCGTTTACCTCCATCAGGTGGTATGGCTGCGCAGGGGAGAACAGTGGCATGGCTGG
CGTCTGGAGCGGTTTGATGAGCGCCGGGCAGTGTTCCGTCACGGCAAGCGCCAGCTAACGCTGAAAGTGC
CGGAGTAA
 Primer design