SecReT4
Protein ID: 238895545
T4SS name [ID]VirB [397]
Gene symbolvirB2
Locus tagKP1_3627
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]3449935..3450228 [+]
Producttype IV secretory pathway VirB2 component
Component typeVirB2
UniProt IDA4GZF9, C4XAQ5
KEGG IDkpu:KP1_3627
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.2e-18, Aligned region: 4..94
Protein Sequence: 97 a.a.     [Download]
>gi|238895545|ref|YP_002920280.1| type IV secretory pathway VirB2 component [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MILFRKLKAVVPPVSACTLTTFSATPALADGFQRANTVMQKVSTGLHGLAAITITVAVIWIGYKTLWKGE
SLSQCGYIIIGGILIGGGSEIGALLMS
 
Nucleotide Sequence: 294 bp     [Download]
>gi|238892256|ref|NC_012731.1|:3449935-3450228 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGATACTTTTCCGCAAGCTAAAAGCTGTGGTCCCCCCCGTTTCGGCCTGTACGCTGACGACTTTTTCTG
CAACCCCGGCACTGGCCGACGGATTTCAGCGGGCAAATACTGTCATGCAAAAAGTGTCAACCGGGCTGCA
TGGTCTGGCGGCAATCACGATCACCGTGGCCGTGATCTGGATTGGCTATAAGACCCTGTGGAAAGGCGAG
AGCCTGTCGCAGTGCGGCTACATCATCATTGGCGGCATTTTAATTGGCGGAGGCAGTGAAATCGGCGCTC
TGCTGATGAGCTAA
 Primer design