SecReT4
Protein ID: 238895550
T4SS name [ID]VirB [397]
Gene symbolvirB8
Locus tagKP1_3633
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]3455245..3455928 [+]
Producttype IV secretion system VirB8 component
Component typeVirB8
UniProt IDC4XAR0, A4GZG3
KEGG IDkpu:KP1_3633
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-51, Aligned region: 10..222
Protein Sequence: 227 a.a.     [Download]
>gi|238895550|ref|YP_002920285.1| type IV secretion system VirB8 component [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MSEQKLIAESRTFEQQMIERDKRATKAGFVVGGVGLLIAVLALVAVVVMLPLKQTDVELYTVDNHTGRVE
HVTRTSKTSLTATEAYQKAMAANYVKVRERYVYPSLQDDYETVQVYNAPQVNDDYLALYAGKNAPDKVYK
NGAHTVKVEILSNQITDATAPDRVATIRYKKIIRRLADNSTRNEYWDARFTFHSDPDKEMSDAEREINYL
GFTVTSWQTDREIRGGE
 
Nucleotide Sequence: 684 bp     [Download]
>gi|238892256|ref|NC_012731.1|:3455245-3455928 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGAGTGAACAGAAATTAATAGCTGAATCCCGCACCTTTGAGCAGCAAATGATTGAGCGGGATAAACGCG
CCACTAAAGCCGGTTTTGTTGTTGGCGGCGTGGGTCTGCTGATTGCGGTACTGGCGCTCGTCGCCGTGGT
CGTGATGTTGCCGCTGAAACAGACGGATGTTGAGCTGTATACCGTGGATAATCATACAGGACGGGTGGAA
CACGTTACCCGGACATCGAAAACCAGCCTGACCGCAACAGAAGCCTATCAAAAGGCGATGGCCGCAAACT
ACGTCAAAGTGCGTGAGCGGTATGTCTATCCCTCTTTGCAGGACGACTACGAGACGGTACAGGTCTACAA
CGCCCCCCAGGTAAACGATGACTACCTGGCGCTTTACGCCGGAAAAAACGCCCCGGACAAGGTTTATAAG
AACGGGGCGCACACCGTGAAAGTGGAGATCTTGTCCAACCAGATCACCGATGCGACAGCCCCTGATAGGG
TCGCCACCATCCGCTACAAGAAGATTATCCGCCGTCTGGCTGATAATAGCACCCGCAACGAATATTGGGA
TGCCCGGTTCACGTTCCATTCTGACCCTGACAAGGAAATGAGCGATGCGGAACGCGAGATCAACTACCTC
GGCTTTACCGTCACCAGCTGGCAGACCGACCGCGAAATCCGGGGAGGTGAATGA
 Primer design