SecReT4
Protein ID: 238895553
T4SS name [ID]VirB [397]
Gene symbolvirB11
Locus tagKP1_3636
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]3458117..3459142 [+]
Producttype IV secretory pathway VirB11 component
Component typeVirB11
UniProt IDA4GZG6, C4XAR3
KEGG IDkpu:KP1_3636
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.7e-45, Aligned region: 18..279
Protein Sequence: 341 a.a.     [Download]
>gi|238895553|ref|YP_002920288.1| type IV secretory pathway VirB11 component [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MTAKNISLDRYKQRFFGDFLELPGLTEIAVNRPGELYTKINGVWEQHAVPLSYEDCYNFARCLAKHHGDN
IEDIKPGLSATLESGERCQVIVPPACERDTVSITIRKPSKVQIPHQSYIDAGFYNRVTGEEKTDTHDEEL
IALYNSKNIPLFMEKCVEYGKTLAVAGETSTGKTTYMKMLIGFFPIHLRISTIEDNPEITFFIHKNYVHL
FYPSESSDEKGSIVTPASLLRWNYRMNPDRILLTEVRGAEAWDFLKITGSGHEGSMTSIHAGSAKEAIDG
FITRCYENPQCAQLPYTFMLRKVLDSLDVIVSIDLDRNVRRMNDIYFRPIHRNQYFEEMKA
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|238892256|ref|NC_012731.1|:3458117-3459142 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGACCGCTAAGAATATTTCCCTCGACCGCTATAAACAGCGTTTCTTTGGCGACTTTCTGGAGCTTCCTG
GCCTGACGGAGATCGCCGTCAACCGTCCAGGTGAGCTGTATACCAAAATCAACGGCGTATGGGAGCAGCA
CGCCGTTCCTTTGTCCTATGAGGATTGCTACAACTTTGCCCGGTGCCTGGCAAAGCACCACGGCGACAAT
ATCGAAGATATTAAGCCGGGGCTGTCAGCCACGCTGGAATCTGGCGAACGGTGCCAGGTGATTGTTCCCC
CGGCCTGTGAGCGCGATACGGTGTCTATCACCATCCGTAAGCCATCAAAGGTACAAATCCCGCATCAGTC
GTATATCGATGCGGGATTTTATAACCGGGTAACAGGCGAGGAAAAAACGGATACGCACGACGAGGAATTA
ATTGCATTGTACAATTCAAAAAATATTCCTCTGTTTATGGAGAAATGCGTCGAGTACGGTAAAACTCTCG
CGGTCGCCGGGGAAACAAGTACCGGGAAAACCACCTATATGAAAATGTTGATAGGGTTTTTTCCTATACA
TCTTCGGATATCAACCATTGAGGACAACCCGGAAATCACGTTCTTTATCCATAAAAACTACGTCCATCTT
TTTTATCCGTCAGAATCATCAGATGAAAAAGGTTCTATCGTTACCCCGGCGAGCCTTTTACGCTGGAATT
ACCGTATGAACCCTGACCGAATTTTATTAACAGAGGTTCGCGGTGCGGAAGCCTGGGACTTCCTTAAAAT
AACGGGTTCCGGCCATGAAGGGAGTATGACCTCCATTCATGCAGGATCAGCGAAAGAAGCTATAGATGGG
TTTATTACCCGTTGCTATGAAAATCCACAGTGCGCCCAGCTCCCTTATACATTTATGTTACGTAAGGTTC
TGGATAGCCTGGACGTGATTGTGAGCATTGATTTAGACAGAAATGTCCGCCGTATGAATGACATTTATTT
CCGTCCAATTCATCGCAATCAATATTTTGAGGAAATGAAAGCATGA
 Primer design