SecReT4
Protein ID: 238895558
T4SS name [ID]VirB [397]
Gene symbolmobB
Locus tagKP1_3641
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]3460903..3462792 [+]
Productmobilization protein
Component typeVirD4
UniProt IDA4GZH1, C4XAR8
KEGG IDkpu:KP1_3641
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 9.8e-05, Aligned region: 430..536
Protein Sequence: 629 a.a.     [Download]
>gi|238895558|ref|YP_002920293.1| mobilization protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MGRIADEGGIMILNKLAASLSPIVNGMLAVLAFVQQKQLVLALLAGLTMPFFASMKSDERQKAPLWKRLI
IAFSLLCFLSGTLAPIVIGSFQWLYKTRLTSDNTVLAWSVRIAFTVTGIIFHIMLRRVITPELDKIKKHL
VKKTTLERELRTDVRTVKSLLPQTLHYNPLDYIDLNKGIFTGMDRENEPMYLPLKDWQKQHADIIGTTGA
GKGVATGILLYQSILAGEGVFVMDPKDDEWAPHLYRKACEDAGKPFALIDLRKQQYQLNLIEDITPDELE
ELFVAGFSLAEKGQESDFYRIDDRKAARMAAQFVSDNPSTTIRDVYNGDYVQGIAEKIKAFFGKIEELAL
LNAINSPEGFSLKKIFDEGGCCYVIGSMRNSKIITAQRMLLVRLYQLAERRERVTDVPRPIAIYLSELKY
HLSRPALEGLGAARDKGVHIVMDHQSIADLKDCPADLKGDAVVGAVVENAKFKLVYRVMDPDTADWVARM
SGTILVDDELRKAKTDNMLTETIDSERTIRQAERFFIDSNMILNLPDFVSFIFTTKTLPSASLISPIKVR
KRRLKTFSVSPDIAAAAAPVRVALDFGDDDKPTALDEMTSHPALFFDENEVKPAKPQPGEEERLSPLDF
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|238892256|ref|NC_012731.1|:3460903-3462792 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGGGGCGAATCGCTGACGAAGGAGGCATCATGATTTTAAATAAGCTTGCCGCTTCACTGTCCCCGATAG
TGAACGGGATGCTGGCGGTGCTGGCTTTTGTGCAACAGAAACAACTGGTGCTGGCATTATTAGCGGGGCT
GACGATGCCGTTTTTTGCATCAATGAAAAGCGATGAACGCCAAAAAGCCCCGTTATGGAAAAGGTTGATT
ATCGCTTTTTCCCTGCTGTGTTTTCTCTCTGGCACACTGGCCCCGATAGTTATCGGATCCTTCCAGTGGC
TGTATAAGACCAGACTCACCAGTGATAATACGGTACTGGCCTGGTCAGTACGGATTGCTTTCACTGTAAC
CGGAATTATTTTTCATATTATGCTTCGCCGGGTAATCACGCCTGAACTGGACAAAATAAAGAAACATCTT
GTTAAAAAAACCACCCTTGAACGCGAATTGCGCACCGATGTCCGCACCGTAAAGTCCCTGCTGCCGCAAA
CACTGCATTATAATCCACTGGATTATATTGACCTGAATAAAGGCATTTTTACTGGCATGGACAGGGAGAA
CGAACCAATGTATCTCCCGTTAAAAGACTGGCAGAAACAACACGCGGATATTATTGGCACCACTGGAGCT
GGGAAAGGGGTTGCCACCGGCATATTGCTTTATCAAAGTATTCTGGCCGGTGAAGGTGTCTTTGTTATGG
ACCCCAAGGATGATGAATGGGCTCCACACCTTTATCGGAAAGCCTGCGAGGATGCAGGAAAACCCTTTGC
CTTAATTGACCTGCGAAAACAGCAATACCAGCTAAACCTGATTGAAGATATTACGCCAGACGAACTGGAA
GAATTGTTCGTTGCAGGTTTCAGTCTGGCGGAAAAAGGTCAGGAATCTGACTTTTATCGGATCGACGACC
GGAAAGCCGCCCGTATGGCCGCACAATTTGTCAGCGATAATCCATCGACAACAATCCGTGATGTTTATAA
TGGTGATTACGTTCAGGGTATTGCCGAAAAAATCAAAGCATTTTTTGGCAAGATTGAGGAGTTGGCATTA
CTCAATGCCATTAATTCACCGGAGGGTTTTTCACTCAAAAAAATATTTGATGAAGGTGGCTGCTGTTATG
TTATCGGCTCCATGCGAAACAGCAAAATCATTACCGCTCAGCGTATGCTGCTGGTTCGCCTTTACCAGTT
AGCAGAAAGGCGCGAACGTGTAACAGACGTACCCCGCCCCATTGCTATTTATCTTTCCGAACTGAAATAC
CATTTATCCAGGCCAGCGCTGGAAGGTTTAGGCGCGGCTCGGGATAAAGGCGTGCATATTGTTATGGATC
ACCAGTCCATTGCCGATTTAAAAGACTGCCCGGCAGATTTGAAAGGCGACGCCGTTGTCGGTGCGGTCGT
TGAAAATGCCAAATTCAAACTAGTTTATCGGGTTATGGACCCGGATACGGCAGACTGGGTGGCCAGAATG
TCAGGCACGATTCTGGTGGATGATGAACTTCGTAAGGCTAAAACGGATAATATGCTGACGGAGACCATCG
ACAGTGAGCGCACAATCCGCCAGGCCGAACGTTTCTTTATTGACAGCAATATGATCCTGAACCTGCCCGA
TTTTGTCAGCTTTATCTTTACGACAAAAACACTACCTTCTGCATCATTAATTTCACCGATAAAGGTCAGA
AAGCGCCGGTTAAAAACCTTTTCTGTTTCCCCTGATATTGCCGCAGCGGCGGCACCTGTGAGGGTTGCAC
TGGATTTTGGTGACGATGATAAACCAACCGCGCTGGATGAGATGACATCGCATCCGGCTCTTTTCTTCGA
CGAAAACGAAGTCAAACCGGCAAAGCCCCAACCTGGTGAGGAAGAACGCCTGTCCCCGCTGGATTTTTAA
 Primer design