SecReT4
Protein ID: 238897637
T4SS name [ID]VirB [437]
Gene symbolvirD4
Locus tagHDEF_0414
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]416695..417393 [-]
ProductVirD4 conjugal transfer protein
Component typeVirD4
UniProt IDC4K3M5
KEGG IDhde:HDEF_0414
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.6e-30, Aligned region: 33..174
Protein Sequence: 232 a.a.     [Download]
>gi|238897637|ref|YP_002923316.1| VirD4 conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MRRKEKSLYSPTKPQKRIERFPPILIGKHPTEDDFLASYGQTFVMLAAPPGTGKGVGMVIPNALTYPDSM
VINDPKFENWHLTAGFRASCGQEVFRFSPEMLETHRWNPLSRLNRDPLFRLGDIKSMASVLFVPDNPKNA
SFFSASADIFTALVLYLMETPSLPLTLPQIYEISAQGMVLGEWAKKEMEARSQGDQPLSSECLREMNRMV
SSSQSKTGWPITQDILNKRLSL
 
Nucleotide Sequence: 699 bp     [Download]
>gi|238897251|ref|NC_012751.1|:c417393-416695 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
GTGAGGAGAAAAGAAAAATCGCTCTATAGCCCGACAAAGCCGCAAAAACGAATAGAGAGATTTCCCCCTA
TCCTCATAGGAAAACATCCGACTGAGGATGATTTTCTGGCGTCCTATGGTCAAACGTTTGTGATGCTGGC
GGCCCCTCCGGGTACAGGGAAAGGGGTGGGGATGGTGATCCCCAATGCGCTGACCTACCCTGATTCTATG
GTGATTAACGATCCAAAATTCGAAAACTGGCATTTAACCGCGGGCTTTCGGGCTTCTTGTGGTCAGGAAG
TCTTTCGTTTTTCGCCGGAAATGCTGGAAACGCACCGTTGGAATCCGTTATCCCGTTTAAACCGGGATCC
CCTGTTTCGTCTCGGTGACATTAAATCGATGGCCAGTGTCCTGTTTGTCCCTGACAACCCGAAAAATGCC
AGTTTTTTTAGCGCCTCTGCGGATATCTTCACCGCGTTAGTGTTGTATCTGATGGAAACGCCGTCATTGC
CGTTGACGCTGCCTCAGATTTATGAAATTTCGGCGCAGGGCATGGTGTTGGGTGAGTGGGCAAAAAAGGA
AATGGAAGCCCGTTCTCAGGGTGATCAGCCGCTGTCGTCAGAATGTCTGCGTGAGATGAACCGCATGGTT
TCGTCTTCTCAGAGCAAAACAGGCTGGCCGATCACACAGGATATTTTAAACAAAAGGTTGTCGTTATAG
 Primer design