SecReT4
Protein ID: 238897639
T4SS name [ID]VirB [437]
Gene symbolvirB11
Locus tagHDEF_0416
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]417751..418776 [-]
ProductVirB11 conjugal transfer protein
Component typeVirB11
UniProt IDC4K3M7
KEGG IDhde:HDEF_0416
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.1e-50, Aligned region: 21..311
Protein Sequence: 341 a.a.     [Download]
>gi|238897639|ref|YP_002923318.1| VirB11 conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MADDFNSLLARDFLAQSGVTQRLSRDGVTEVAINRPFEIWTESALGWVQESVPELDYDLCWKLANSLSTY
NHRFLSIQSPIKTVELPGGERAQIVIPPACEAGTISMTFRKPSLERFRLEDYLSSGRFDKAKNISCRQKT
LESVEVKLKQLHAEQDYVAFFKKAVQHKLNIIIFGGTGSGKTTFAKAVVDLFPPDRRMLTIEELNELKLP
YHPNHVHLLYGDTVSSKELVSCCMRMKGDHIFLAELTGDEAWDFMELLNTGHPGTITTAHANDSLSGYAR
VCGLIKQSPIGQGLDYAYIERRVRTSFDVVMYMEGTHILEVTYEPEVKQALLNGGSFCSSF
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|238897251|ref|NC_012751.1|:c418776-417751 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGGCCGATGATTTTAACTCGTTGCTCGCGCGGGATTTTTTGGCGCAAAGTGGGGTCACGCAGCGGTTAA
GTCGTGACGGTGTGACGGAAGTGGCCATTAATCGGCCCTTTGAAATCTGGACGGAATCAGCCCTGGGTTG
GGTACAAGAATCTGTCCCCGAACTCGATTATGACTTGTGCTGGAAGCTGGCCAACAGCCTTTCGACCTAT
AACCATCGGTTTTTATCGATTCAGTCACCGATAAAAACAGTGGAATTACCCGGAGGCGAGCGGGCGCAAA
TTGTGATCCCTCCTGCCTGTGAAGCCGGCACCATCTCAATGACCTTTCGTAAACCGTCACTGGAGCGATT
CAGGCTGGAAGATTACCTCAGCAGTGGACGTTTTGATAAAGCGAAGAATATCAGTTGCCGACAAAAAACT
CTTGAGTCTGTTGAAGTCAAATTAAAGCAACTTCATGCTGAGCAGGATTATGTGGCTTTTTTCAAAAAAG
CCGTCCAGCACAAACTCAATATCATTATTTTTGGGGGGACGGGTTCCGGTAAAACCACCTTTGCCAAAGC
AGTGGTTGACCTTTTCCCCCCCGACCGGCGAATGCTGACCATTGAAGAACTGAACGAATTAAAACTCCCG
TATCACCCAAACCATGTTCATCTTTTATATGGAGACACGGTTTCATCCAAAGAACTGGTTTCCTGCTGCA
TGAGGATGAAAGGGGATCATATTTTCCTGGCGGAATTAACGGGGGATGAAGCCTGGGACTTCATGGAGCT
ACTGAACACAGGGCATCCAGGTACCATCACCACGGCACATGCTAACGACAGCTTATCGGGATATGCGCGG
GTCTGTGGACTGATCAAGCAATCCCCCATAGGGCAGGGACTCGATTATGCGTATATCGAGCGGCGGGTCA
GGACTTCGTTTGATGTGGTGATGTACATGGAAGGCACTCACATTCTGGAAGTGACCTATGAACCGGAGGT
CAAGCAGGCTTTGCTTAACGGTGGTTCGTTTTGCTCCTCTTTTTAA
 Primer design