SecReT4
Protein ID: 238897640
T4SS name [ID]VirB [437]
Gene symbolvirB10
Locus tagHDEF_0417
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]418766..419431 [-]
ProductVirB10 conjugal transfer protein
Component typeVirB10
UniProt IDC4K3M8
KEGG IDhde:HDEF_0417
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 9.9e-50, Aligned region: 33..209
Protein Sequence: 221 a.a.     [Download]
>gi|238897640|ref|YP_002923319.1| VirB10 conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MSIGEGRRGRLSTLSGTGFESSKAYVMPSRQFLVTHNTYTRCALYTRIITDQPGLIECRLTEPLYSSDGS
VVIAQAGDKLTGEQKVEVRAGQTRVFTSWTELETASGVRAKLDSLGAGPMGASGTEAWIDHHYRQRFGGA
VMLSFIQDALHSAANATQKSNQGYTVNNSEQNVESMANQALENSINIPPTAYILPGTVMTVIVARDIDFS
SVFTLREQNGR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|238897251|ref|NC_012751.1|:c419431-418766 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGAGTATAGGAGAGGGCCGCCGAGGGCGTTTATCGACCCTTTCAGGTACAGGGTTTGAATCGAGCAAAG
CCTATGTGATGCCATCACGTCAATTTTTGGTGACCCATAACACCTATACCCGCTGTGCGCTCTATACCAG
GATCATCACAGATCAACCCGGTTTAATCGAATGTCGTCTGACTGAACCGCTGTATTCGTCTGATGGTTCT
GTGGTGATTGCGCAAGCGGGAGACAAATTGACCGGAGAACAAAAAGTGGAAGTTCGGGCGGGGCAAACGC
GCGTATTTACATCCTGGACTGAACTGGAAACGGCCAGCGGTGTCAGGGCAAAGCTAGACAGCCTGGGAGC
AGGTCCGATGGGGGCGAGCGGAACGGAAGCCTGGATAGACCATCATTACAGGCAGAGATTTGGCGGGGCC
GTCATGTTGTCATTTATTCAGGATGCGTTGCACTCAGCGGCGAATGCGACCCAAAAAAGTAACCAGGGTT
ACACCGTCAATAACAGCGAGCAGAACGTAGAAAGCATGGCCAACCAGGCTCTGGAGAACAGCATCAACAT
TCCTCCTACCGCTTATATTTTGCCGGGTACCGTGATGACCGTCATTGTAGCGCGTGATATTGATTTTTCT
TCTGTATTTACGCTGAGGGAACAGAATGGCCGATGA
 Primer design