SecReT4
Protein ID: 238897642
T4SS name [ID]VirB [437]
Gene symbolvirB9
Locus tagHDEF_0419
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]420074..420874 [-]
ProductVirB9 conjugal transfer protein
Component typeVirB9
UniProt IDC4K3N0
KEGG IDhde:HDEF_0419
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.6e-51, Aligned region: 30..239
Protein Sequence: 266 a.a.     [Download]
>gi|238897642|ref|YP_002923321.1| VirB9 conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MKKWMAATFIFAAFAYEVPAETLGRGSSLDKRIRTALYSPDNVYRLNTMKNRTSTIQFPSGETVNLGSGL
IATGHPGAWVIGANQEGNMVVVKPEMNAIEPDTNVIINTNKRTYLIELRLIDNPAAMTYLLRFKYPEPPK
PAKTRFKGSQLNKNPCDGRINRHYQKRGDMPLSPDEMWDNGTFTCLRFPTNAPRPVIYQVLPDGTETLAN
VRSVNDIMVVHGVSQRFRLRLNRLVLELRTEQNNTGGYNYHGTTTGQIREVKDVGQ
 
Nucleotide Sequence: 801 bp     [Download]
>gi|238897251|ref|NC_012751.1|:c420874-420074 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGAAAAAATGGATGGCCGCTACGTTTATTTTCGCTGCCTTCGCGTATGAGGTGCCGGCAGAAACTCTGG
GCCGGGGATCTTCCCTGGATAAACGTATTCGGACTGCGCTCTACAGCCCAGATAACGTCTACCGGTTAAA
TACCATGAAAAACCGGACGTCTACGATTCAATTCCCATCAGGAGAAACGGTCAATCTAGGGAGTGGGCTG
ATTGCCACAGGTCATCCCGGAGCCTGGGTGATTGGGGCGAATCAAGAGGGCAATATGGTGGTTGTCAAGC
CGGAGATGAACGCCATTGAGCCTGACACCAATGTCATCATTAACACGAATAAACGTACCTACCTCATTGA
GTTGAGATTAATCGATAATCCGGCGGCCATGACTTACCTGCTTCGTTTTAAGTATCCTGAACCGCCAAAA
CCGGCAAAAACGCGCTTTAAGGGGAGTCAACTGAACAAAAATCCCTGTGATGGCAGAATAAACCGGCATT
ATCAAAAGCGGGGAGACATGCCTTTGTCGCCTGATGAAATGTGGGATAACGGCACATTTACCTGTTTGCG
TTTCCCGACGAATGCCCCGCGGCCGGTTATCTATCAGGTGCTCCCTGATGGCACGGAAACATTGGCGAAC
GTGCGTTCAGTGAACGATATCATGGTGGTTCATGGGGTCAGTCAACGGTTCAGGTTACGCCTGAACCGTC
TGGTTCTTGAACTGCGTACTGAGCAAAACAATACCGGCGGGTACAACTATCACGGGACGACCACCGGTCA
AATCAGGGAGGTCAAAGATGTCGGTCAATGA
 Primer design