SecReT4
Protein ID: 238897643
T4SS name [ID]VirB [437]
Gene symbolmobB_1
Locus tagHDEF_0420
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]420878..423994 [-]
ProductMobB relaxase/mobilization protein
Component typeVirB8
UniProt IDC4K3N1
KEGG IDhde:HDEF_0420
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.6e-49, Aligned region: 822..1034
Protein Sequence: 1038 a.a.     [Download]
>gi|238897643|ref|YP_002923322.1| MobB relaxase/mobilization protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MLIRVRGYNKGIKAYLEKGIKNGRDYGREELDERVILDGDLDLTEIIYQQIPDKGQDRYLTFTLSFRENE
VSKEILNNITQEFREFFMYAYEDEEYHFYAEAHLPKIKAMKDKKTGEMIERKPHIHIVIPKKNVLSGKIG
DPLGSHFSQSVKYLEAFQEYINQKYQLASPRDSIRVDPTQAADVLSRYKGDDFRSQHQSFKRQLIFDVIE
KNIRDREAFYGHVSSFGETKLRHKGKENEYIAVKLPGEAKWTHLKETIFQDDFVVRREVKKPPLDKTIIR
DRLCGWPQRAKEIKYVSKATPQFRHRYRWASPEEKIQLLTQRQTAFYEKYREIYDLYPAERKSDQQRSSA
QTERERAACAPHGLQSVSCGDVATDRDSEYAENTVFLPGHAYVHLGQSTSGRSARLRSDLSAGGRRRGAS
GQPDFDRFTALSGVPTVEDIARRQGFRIRDGLGGSPAGTLTLPPYARDLYRVATLEEIKQRGKRLFGASE
RPLKSNTVSSLRRLMPKPDKNASFLAAYFLRQHEQNSILPEHRQAIRAVDRQFFTARRTILSDNRLTRDE
KTQSVSVFTFERLKAHEAIKQLEIAFKQERPDMGSADIRQKIKATRIPNPSFSGDTVEGAEIPPARARFA
RLIQHLSGHFTENRLRDRQRMMSASDLYTKRAKLSKNVHYLDKKTDRTLFVDIGHAIAVRKGGMTDSAVA
VALSLAKEKFGSTLTIKGSDDFKKQVIEVAVRDYLDVHFTDKVMNRQFEERKEERAIEREGQRVEEPTKS
RDPDPEKASVDDEDPSLERTHDNNLGEQKKKSHVEPSPPDEETEGPTLKNVAQEYRRQARHSQYLCIFFG
VLALMSLGAVLGLTPLKTVEPYLVRVDNHSGYTDIVAPLTAGKKTDQVQDEYWLSTYVRTYESYNWSSQT
SNYALIKLFSYSDPFTEYKNFQLSSKGYTEILGKNRQIRTKINHIVPMRAAIGKELQADKEIKTYQVRFT
KTILDRHGNPDPQSQVTHWLATVSFDYHNPSVTQEERWLNPLEFGVHAYSKTQEVKGG
 
Nucleotide Sequence: 3117 bp     [Download]
>gi|238897251|ref|NC_012751.1|:c423994-420878 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGTTGATTAGAGTGAGGGGATACAATAAGGGAATTAAAGCCTATCTTGAAAAAGGCATTAAAAATGGCC
GGGATTATGGCCGGGAAGAATTAGATGAACGGGTTATTCTAGATGGCGACCTGGACTTAACCGAAATCAT
CTATCAACAAATACCGGACAAAGGACAAGACAGATATCTGACGTTCACGCTGTCATTTCGTGAAAATGAG
GTTTCAAAAGAAATATTAAATAATATCACTCAAGAATTTCGTGAATTTTTTATGTACGCTTATGAGGATG
AAGAATATCACTTTTATGCAGAAGCGCATTTACCCAAAATAAAAGCAATGAAAGATAAAAAAACGGGAGA
AATGATTGAACGTAAACCGCATATCCATATTGTGATTCCCAAAAAAAATGTATTGTCGGGCAAAATAGGT
GATCCCCTCGGTTCTCATTTTTCTCAATCCGTCAAATATCTGGAAGCCTTCCAGGAATATATTAACCAAA
AATATCAACTGGCCTCTCCGAGAGATTCTATTCGAGTTGACCCCACTCAGGCGGCTGATGTGCTCTCTCG
CTATAAAGGGGATGATTTCAGGAGCCAGCATCAGTCTTTTAAAAGGCAGCTTATCTTTGATGTCATTGAG
AAAAACATCAGGGATCGCGAGGCCTTTTATGGGCATGTTTCCTCTTTTGGTGAAACAAAACTCCGTCATA
AAGGAAAGGAGAATGAATATATCGCAGTCAAACTGCCTGGTGAGGCAAAATGGACTCACTTGAAAGAAAC
GATATTTCAGGATGATTTTGTGGTTCGTCGAGAAGTCAAAAAGCCGCCTCTGGATAAAACGATTATCCGT
GACCGATTGTGTGGGTGGCCTCAGCGGGCGAAAGAGATCAAATATGTGAGCAAAGCAACGCCTCAATTTA
GGCATCGGTATCGATGGGCCTCCCCTGAAGAAAAAATTCAGCTCCTGACCCAACGTCAGACCGCTTTTTA
CGAAAAATACAGAGAGATTTATGACTTATACCCTGCCGAACGGAAAAGTGATCAGCAGCGAAGTTCTGCT
CAAACTGAAAGAGAAAGAGCTGCCTGCGCTCCCCATGGCTTGCAAAGTGTGTCCTGCGGCGATGTGGCAA
CTGACAGGGACAGTGAATACGCCGAAAATACGGTGTTTTTGCCGGGTCATGCATACGTTCACTTGGGACA
GTCAACATCAGGAAGAAGTGCTCGATTGCGATCTGATTTATCAGCAGGAGGAAGAAGAAGAGGAGCCTCA
GGGCAACCCGACTTCGACCGGTTTACCGCCCTTTCTGGCGTCCCAACTGTTGAAGACATCGCCCGAAGAC
AGGGTTTCAGGATCAGAGATGGCCTGGGAGGAAGCCCCGCCGGAACATTGACCCTGCCGCCTTATGCGCG
GGATCTGTATCGGGTAGCGACGCTGGAGGAGATAAAGCAGAGAGGAAAGCGACTTTTTGGTGCCTCTGAA
CGGCCCTTAAAGTCTAATACAGTGAGTTCTCTTCGTCGCCTGATGCCCAAGCCAGATAAAAACGCTTCTT
TTTTGGCGGCTTATTTTCTGAGACAGCATGAACAGAACTCAATATTACCCGAGCACCGACAAGCAATACG
CGCTGTAGACAGGCAGTTTTTTACTGCCCGTCGCACCATTTTGAGTGATAACAGATTGACCCGTGATGAA
AAGACGCAGTCTGTCTCTGTATTCACTTTTGAACGTTTGAAAGCCCATGAGGCTATCAAACAGCTTGAGA
TTGCTTTTAAACAGGAGAGACCCGACATGGGGAGTGCCGATATTCGCCAGAAGATTAAAGCCACTCGAAT
TCCTAACCCCTCTTTCAGCGGTGATACGGTGGAAGGTGCCGAGATTCCTCCTGCCAGAGCGCGTTTCGCG
CGTCTGATTCAACACTTGAGCGGACACTTCACTGAAAATCGACTTCGTGATCGTCAGCGGATGATGTCAG
CCAGTGATCTTTACACGAAGCGGGCGAAACTCAGCAAAAATGTGCATTACCTGGATAAAAAGACGGACCG
TACGCTGTTTGTTGATATCGGCCATGCCATTGCGGTGCGCAAAGGGGGCATGACCGATTCCGCGGTCGCC
GTTGCCTTGTCCCTGGCAAAAGAGAAATTTGGGAGTACGCTCACCATCAAAGGAAGCGATGACTTCAAAA
AACAGGTGATTGAGGTGGCGGTTAGGGATTACCTCGACGTGCATTTTACCGATAAAGTGATGAACCGGCA
GTTTGAAGAGCGCAAGGAAGAACGGGCGATAGAGCGGGAGGGGCAGCGTGTTGAAGAGCCGACAAAGAGT
CGTGACCCCGATCCTGAAAAAGCCTCCGTTGACGATGAGGATCCGTCATTAGAGAGGACTCATGATAACA
ATCTGGGGGAGCAAAAAAAGAAAAGTCATGTTGAACCGAGCCCCCCCGATGAAGAGACGGAGGGTCCCAC
CCTTAAAAACGTGGCGCAGGAATATCGCCGTCAAGCCCGTCACAGTCAGTATCTGTGTATTTTTTTTGGG
GTGCTGGCGTTGATGTCCCTCGGCGCAGTGTTGGGACTGACTCCCCTGAAAACGGTAGAGCCGTATCTTG
TCCGAGTGGATAATCATTCGGGTTATACCGATATTGTGGCGCCTCTGACGGCGGGGAAAAAAACCGATCA
GGTGCAGGATGAATATTGGCTGTCGACCTATGTTCGTACCTATGAATCCTATAACTGGAGTTCACAAACC
TCAAACTATGCGCTGATTAAGCTCTTTTCTTATAGTGACCCGTTCACGGAATACAAAAATTTTCAGCTGT
CCAGTAAAGGCTATACCGAAATATTGGGTAAAAATCGGCAAATTCGGACAAAAATTAACCACATTGTGCC
CATGAGGGCGGCCATCGGCAAGGAACTTCAAGCGGATAAAGAGATAAAAACCTATCAGGTGCGTTTCACC
AAAACCATTCTTGATCGTCACGGAAATCCCGATCCGCAAAGCCAGGTCACCCATTGGCTGGCGACGGTCT
CGTTTGATTATCACAATCCTTCGGTGACGCAGGAAGAGAGATGGCTCAATCCCCTGGAATTTGGCGTGCA
CGCCTACTCAAAAACGCAGGAAGTCAAAGGAGGGTAG
 Primer design