SecReT4
Protein ID: 238897651
T4SS name [ID]VirB [437]
Gene symbolvirB6
Locus tagHDEF_0428
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]427223..428173 [-]
ProductVirB6 conjugal transfer protein
Component typeVirB6
UniProt IDC4K3N9
KEGG IDhde:HDEF_0428
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.4e-35, Aligned region: 41..266
Protein Sequence: 316 a.a.     [Download]
>gi|238897651|ref|YP_002923330.1| VirB6 conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MDVYIAKTLYQAIDEGLKGTIAIGTANVMTLTGVIFGTCWLIHLTLKSIYWLFQGLDVAFQDLLLTLGKA
SFIIYFAFNVRWYIDTVVPVVNGLPNWMAQTLSSSGLAQSNQVDTVISNFFTALNNTIGALEFSIWKEAA
AMCLGFLALLFFLLGGIPFIMVVVGTLITLKAATSIILVVGPIFIAFSLFDQTRQWFWGWVSVIGGFMLT
QILFGVVLAIELNFIHSVIIKNGKIETDILSCFALLLYFSAFTLLATELPNYAASIMGGTPSGGVSGVGG
ILGRGTGLRAAGNMSQAAGKGIMKGVNKLRNRNRIT
 
Nucleotide Sequence: 951 bp     [Download]
>gi|238897251|ref|NC_012751.1|:c428173-427223 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGGACGTGTATATTGCAAAAACGCTATATCAGGCCATAGACGAGGGGTTAAAAGGCACCATTGCCATAG
GGACAGCCAATGTCATGACTCTGACCGGTGTGATATTCGGCACCTGCTGGCTTATTCATTTAACTCTAAA
AAGTATTTACTGGCTTTTTCAGGGATTAGATGTGGCATTTCAGGATTTGCTTTTAACCCTCGGTAAAGCC
TCATTTATTATTTATTTTGCTTTTAACGTTCGCTGGTATATCGATACGGTGGTACCCGTGGTTAACGGGT
TGCCTAACTGGATGGCGCAGACGCTTTCTTCTTCAGGATTAGCGCAGTCTAATCAGGTAGATACTGTGAT
ATCTAATTTTTTCACCGCATTAAACAATACGATAGGGGCTCTAGAGTTCAGTATTTGGAAAGAAGCCGCC
GCTATGTGTCTTGGGTTTCTGGCTCTCCTGTTTTTTCTGTTGGGCGGGATACCCTTTATCATGGTTGTGG
TGGGGACCCTGATTACCTTAAAAGCGGCCACCTCAATCATTCTGGTGGTGGGGCCCATTTTTATTGCTTT
TTCTTTATTTGATCAGACGCGGCAATGGTTCTGGGGCTGGGTGTCAGTCATCGGTGGCTTTATGCTGACG
CAAATATTATTTGGTGTGGTCTTGGCGATTGAATTGAATTTCATTCATAGTGTGATCATAAAGAATGGCA
AAATAGAGACGGACATATTGAGTTGTTTCGCCCTACTGCTTTATTTTAGCGCCTTTACTCTGTTAGCGAC
TGAACTGCCTAATTATGCCGCCTCTATCATGGGAGGTACTCCTTCTGGGGGTGTGAGTGGCGTGGGTGGG
ATATTGGGACGAGGTACGGGATTAAGAGCGGCGGGGAACATGAGTCAAGCGGCGGGTAAAGGCATCATGA
AAGGCGTCAATAAATTAAGGAATAGAAATAGAATTACTTAA
 Primer design