SecReT4
Protein ID: 238897655
T4SS name [ID]VirB [437]
Gene symbolvirB5
Locus tagHDEF_0432
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]429281..429967 [-]
ProductVirB5 conjugal transfer protein
Component typeVirB5
UniProt IDC4K3P3
KEGG IDhde:HDEF_0432
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 5.8e-31, Aligned region: 31..213
Protein Sequence: 228 a.a.     [Download]
>gi|238897655|ref|YP_002923334.1| VirB5 conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MTDLENLRKKTAVTVLLAGIYLFMPGSKAEIPTISPAELAQQVTHAKQQSREAVAQLKKAKEAIAQTKSQ
YDHYQKLIQGNSKLGDFLNDPVVNNLIPMGDWEDIYNDIESLPNLRQRYGLTSVDPEVQKAFDQLLMKAG
TLEKEKKASDQRVLNAQKLRAKLNVVQTPQEKQDLSLRYQQEMLELQIQQTRLQNMRALAEEKEKLADRK
RAQDFTDYMLRKRPDLPK
 
Nucleotide Sequence: 687 bp     [Download]
>gi|238897251|ref|NC_012751.1|:c429967-429281 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGACCGACTTGGAAAATCTGAGAAAAAAGACGGCAGTGACTGTTCTGTTGGCGGGGATTTATCTATTTA
TGCCGGGGAGCAAGGCAGAGATACCGACCATCAGCCCTGCGGAATTGGCCCAGCAAGTGACCCATGCCAA
GCAACAGTCGAGGGAAGCCGTAGCACAACTCAAAAAAGCCAAAGAGGCGATTGCGCAGACGAAAAGCCAG
TATGATCATTATCAAAAATTGATTCAAGGGAACTCAAAATTGGGAGACTTTCTTAACGACCCTGTGGTCA
ATAACCTGATCCCGATGGGCGATTGGGAAGATATTTACAACGATATCGAGAGCCTACCCAATTTACGCCA
GAGGTACGGTTTGACCTCCGTTGATCCTGAGGTACAAAAGGCGTTTGATCAACTCTTAATGAAGGCGGGC
ACGCTGGAAAAAGAAAAAAAAGCGAGTGATCAGCGGGTGTTGAATGCGCAAAAATTGCGGGCGAAACTGA
ATGTGGTGCAAACGCCGCAGGAGAAACAGGATTTGTCGTTGCGCTATCAGCAAGAAATGTTAGAACTTCA
GATTCAACAGACTCGGTTACAGAACATGAGGGCATTAGCAGAAGAAAAAGAAAAACTGGCCGACCGAAAG
CGAGCTCAGGACTTCACCGATTACATGCTCCGAAAGCGGCCCGATCTGCCAAAATAG
 Primer design