SecReT4
Protein ID: 238897656
T4SS name [ID]VirB [437]
Gene symbolvirB4
Locus tagHDEF_0433
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]429964..431067 [-]
ProductVirB4 conjugal transfer protein
Component typeVirB4
UniProt IDC4K3P4
KEGG IDhde:HDEF_0433
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 6e-13, Aligned region: 3..277
Protein Sequence: 367 a.a.     [Download]
>gi|238897656|ref|YP_002923335.1| VirB4 conjugal transfer protein, partial [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MTNAGKTTLEACMLIHFSRWDPMIFSIDYNHSLENVLRASGTHYFTVSPGVYTGIQPFQFEDSPSLRQFL
FDTVKLCAGKAEPDEEREIQDGIEAVMRHSVIENRSLSLMLQGIPKKGGNCLHTRLAKWCRNVDGHQGQY
AWVLDAPVNLFDPKIFRRLAFDCTKILNKAYSGKHPEAMEVMLNTFFYLKRAMHATEPGSLLINVIAEYW
VPLSFESTAEAIKEILKAGRTRGEILMMDTQSPEDALSTQYAPAVIQQVITQIWMANSKAKRESYREFGI
EGKEFDKVVELIPSSREFMVKQGHQAVMVKFVLDEKLKYWLPLLSSTDENLAVAERIRRDLNTEDPSVWV
CAFLAEMQQRHQQEKTS
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|238897251|ref|NC_012751.1|:c431067-429964 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGACCAACGCCGGAAAAACCACGCTTGAAGCCTGTATGCTCATTCACTTTAGCCGCTGGGATCCGATGA
TTTTTTCTATTGATTACAATCATTCACTGGAAAACGTGCTTCGGGCCTCGGGAACCCATTATTTTACCGT
CTCACCGGGCGTCTATACGGGCATTCAGCCTTTTCAGTTCGAGGATTCGCCGTCTTTACGTCAGTTTCTG
TTCGATACAGTGAAGCTGTGCGCGGGTAAAGCCGAGCCCGATGAGGAACGAGAAATTCAGGATGGTATAG
AAGCAGTGATGCGGCACAGCGTGATAGAAAACCGCTCATTGTCGCTGATGTTGCAAGGGATACCGAAAAA
GGGGGGGAACTGCCTGCACACCCGCCTGGCGAAGTGGTGTCGTAATGTAGACGGCCATCAGGGGCAGTAT
GCGTGGGTGCTGGATGCGCCGGTTAATTTGTTTGATCCCAAAATATTCCGTCGTTTGGCGTTCGACTGTA
CGAAAATCCTGAACAAGGCCTATTCTGGGAAGCATCCTGAGGCCATGGAAGTCATGCTCAATACCTTCTT
CTATCTGAAACGGGCAATGCACGCGACGGAGCCAGGAAGCTTGTTGATCAACGTGATTGCAGAATATTGG
GTTCCTCTCTCGTTTGAAAGTACCGCCGAGGCGATTAAGGAAATTTTAAAAGCGGGGCGGACTCGGGGTG
AAATTTTGATGATGGATACCCAATCTCCAGAGGATGCGCTATCGACGCAATATGCCCCTGCGGTGATTCA
GCAGGTGATCACGCAAATCTGGATGGCCAATAGCAAAGCAAAACGAGAGAGCTATCGGGAGTTCGGCATT
GAAGGGAAAGAATTTGACAAAGTGGTTGAGCTCATTCCCTCCAGTCGTGAATTTATGGTCAAGCAGGGGC
ATCAGGCAGTGATGGTGAAATTTGTCCTGGATGAAAAATTGAAATACTGGTTGCCGCTGCTGTCATCAAC
GGATGAGAACCTTGCGGTGGCAGAGCGTATTCGCCGTGACCTGAATACGGAAGATCCGTCAGTCTGGGTT
TGCGCCTTTCTTGCCGAAATGCAACAGCGTCATCAGCAGGAGAAAACGTCATGA
 Primer design