SecReT4
Protein ID: 238898130
T4SS name [ID]Tra_I [185]
Gene symboltraJ_1
Locus tagHDEF_0959
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]952527..953696 [+]
ProductTraJ conjugal transfer protein
Component typeTraJ_I
UniProt IDC4K520
KEGG IDhde:HDEF_0959
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.7e-34, Aligned region: 25..307
AAA_23 [PF13476], Evalue: 1.7e-05, Aligned region: 153..181
Protein Sequence: 389 a.a.     [Download]
>gi|238898130|ref|YP_002923811.1| TraJ conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MTANSLPPFDFSAGLTADTLRRFFAWCASHQVTDIHLQGGAPMIVGRYGRLIKASAFRLEEARLTQLVDE
IFTPEIKAMVKSGQGVDRALQLEGDANGRYGLPRGERLRFRANFIQATAGRQELTMAVTLRLIPSQIPTL
ESLAIEPELFKNLLPHKGLIWVCGETGSGKSTLLAAIYQYCGRVYPDRKIVTFEDPIEYILGTPENRLPP
TQSQIGRDVSSFSEGLRLALRQAPDVIGVGEIRDGETLMGAIACGQSGHLCLSTLHTHSPAETIPRAVWM
FPPDRREAVAHDLLGILQVIVVQQLLRTTDGQRQAIREYLIFDEAVRQALSELNYTQWSSWINRRLKTQK
TRLADKAWQLYQKGRIADEELLTVMSHREREKRKKNTLL
 
Nucleotide Sequence: 1170 bp     [Download]
>gi|238897251|ref|NC_012751.1|:952527-953696 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGACGGCCAATAGCCTGCCGCCCTTTGATTTCAGCGCGGGATTAACGGCAGACACCCTGCGGCGATTTT
TCGCCTGGTGTGCGAGTCACCAGGTCACCGACATTCATCTCCAGGGCGGCGCGCCCATGATTGTCGGCCG
TTACGGGCGATTGATCAAAGCCAGTGCCTTTCGCCTGGAAGAGGCCAGATTAACCCAGTTAGTCGATGAG
ATATTTACGCCAGAAATCAAGGCGATGGTGAAATCAGGGCAGGGGGTTGATCGGGCACTCCAGCTCGAGG
GCGATGCGAATGGACGCTACGGATTACCACGAGGGGAACGCCTGAGGTTTCGGGCCAATTTCATTCAGGC
CACGGCGGGACGTCAGGAATTAACCATGGCCGTCACCTTAAGGCTCATTCCTTCCCAAATCCCGACCCTC
GAGAGTTTGGCCATCGAGCCTGAGTTATTCAAAAATCTGTTGCCCCATAAGGGATTAATCTGGGTGTGTG
GCGAAACCGGCTCGGGGAAATCAACGTTACTGGCGGCCATTTATCAATATTGTGGGCGGGTGTATCCCGA
TAGAAAAATCGTCACCTTCGAAGATCCCATTGAATATATTCTCGGCACGCCAGAAAATCGTTTGCCTCCG
ACCCAATCCCAAATTGGGCGTGACGTGAGCAGCTTTTCAGAAGGACTGAGACTGGCGCTACGCCAGGCGC
CTGATGTCATTGGGGTGGGAGAAATTCGAGATGGGGAGACCTTGATGGGGGCCATTGCCTGTGGTCAGTC
AGGGCATCTGTGTTTGTCTACCTTGCACACGCATTCCCCCGCTGAAACCATTCCCAGAGCAGTATGGATG
TTTCCCCCAGACAGGCGGGAAGCCGTCGCCCATGATCTGCTGGGGATATTGCAGGTCATTGTCGTGCAGC
AGTTATTACGCACCACAGACGGCCAACGCCAGGCCATTCGTGAATATCTGATTTTTGATGAAGCCGTGCG
ACAAGCGCTCTCTGAGTTGAATTACACCCAATGGAGCTCATGGATTAACCGACGTTTAAAAACGCAAAAA
ACCCGTTTGGCTGACAAGGCATGGCAATTATATCAGAAAGGCCGTATTGCTGATGAAGAGCTCCTCACTG
TCATGAGCCACAGAGAAAGGGAAAAGAGAAAGAAAAATACGCTCTTATGA
 Primer design