SecReT4
Protein ID: 238898135
T4SS name [ID]Tra_I [185]
Gene symboltraL
Locus tagHDEF_0965
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]957505..957936 [+]
ProductTraL conjugal transfer protein
Component typeTraL_I
UniProt IDC4K525
KEGG IDhde:HDEF_0965
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 143 a.a.     [Download]
>gi|238898135|ref|YP_002923816.1| TraL conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MKTLKNLLGCAGLWLISLFTQAEPCRAHQAAQIGSQMGYEQAKKAADAWEKREQYATTALQQCLGSLSTS
LTVPTFPDLSSLLNGIKDKVCAAGREKISRVIPSHINPWEEWTVADYSIPTKTLSASQTILPDPKKGSPF
TLN
 
Nucleotide Sequence: 432 bp     [Download]
>gi|238897251|ref|NC_012751.1|:957505-957936 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGAAAACACTCAAAAACCTTTTAGGGTGCGCAGGCCTATGGTTGATCAGCCTCTTCACTCAAGCCGAGC
CCTGTCGCGCACATCAAGCGGCTCAAATCGGCAGTCAAATGGGGTATGAGCAGGCCAAAAAAGCGGCCGA
TGCCTGGGAAAAACGGGAACAGTACGCCACCACCGCATTACAGCAATGTTTAGGCAGCCTCAGTACCTCG
CTCACCGTCCCGACCTTTCCTGACCTGTCGAGCCTCTTGAATGGCATTAAAGACAAGGTCTGTGCGGCGG
GTCGAGAAAAAATCTCCCGTGTTATCCCGAGCCACATCAATCCTTGGGAAGAATGGACAGTGGCGGACTA
TTCAATCCCAACAAAAACGCTTTCCGCTTCACAAACGATCCTCCCTGATCCAAAAAAGGGATCTCCTTTT
ACGCTCAATTAA
 Primer design