SecReT4
Protein ID: 238898136
T4SS name [ID]Tra_I [185]
Gene symboltraM_1
Locus tagHDEF_0966
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]957961..958632 [+]
ProductTraM conjugal transfer protein
Component typeTraM_I
UniProt IDC4K526
KEGG IDhde:HDEF_0966
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 9.6e-31, Aligned region: 74..180
Protein Sequence: 223 a.a.     [Download]
>gi|238898136|ref|YP_002923817.1| TraM conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MKKNSDLGDNKDNAPYKAALELHHQNQLGAQFARTTLTLCLTTSLCLIVSLLLNGYLGWTVAHPPVKYFA
TQEGRVIPLIPTHQPVLTVSQVSDFGAHTIREAFTMDFVHFKEQMSRVSAYFSEEGFKSYYQALTQSNVL
AAVRDKKMNLAVMLAPGVVRQKGPLSNGVYAWEIQYPVTLKLSGQTRSLPEQRFIFSLFLQRADLREKPN
GLEVTQLVTFDAK
 
Nucleotide Sequence: 672 bp     [Download]
>gi|238897251|ref|NC_012751.1|:957961-958632 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGAAAAAAAATTCCGACCTGGGTGATAATAAGGACAATGCTCCTTACAAAGCGGCTCTTGAGCTCCATC
ATCAAAATCAACTGGGGGCTCAATTTGCCCGAACCACATTAACACTCTGCCTGACAACCAGCCTGTGTCT
CATCGTGTCGCTTCTGCTCAATGGCTATTTAGGCTGGACAGTGGCGCATCCCCCCGTCAAATACTTTGCG
ACACAGGAAGGACGAGTGATCCCACTCATCCCAACACATCAACCGGTGTTGACGGTATCTCAAGTGTCAG
ATTTTGGCGCTCACACCATCCGGGAAGCCTTCACCATGGATTTTGTGCATTTTAAGGAGCAAATGAGCCG
GGTTTCAGCTTATTTTTCAGAAGAAGGATTTAAAAGTTATTACCAGGCGTTGACACAATCGAACGTCTTA
GCCGCCGTCCGAGACAAAAAAATGAATCTGGCCGTCATGTTAGCGCCCGGCGTCGTTCGCCAAAAAGGGC
CTTTGTCCAATGGCGTCTATGCGTGGGAAATCCAGTATCCCGTGACCTTAAAACTCTCAGGACAGACGCG
GTCTCTACCCGAGCAACGCTTTATTTTTTCTCTCTTTCTGCAACGCGCCGATCTGAGAGAAAAACCCAAT
GGACTGGAAGTGACTCAATTAGTCACCTTTGATGCGAAATGA
 Primer design