SecReT4
Protein ID: 238898140
T4SS name [ID]Tra_I [185]
Gene symboltraU
Locus tagHDEF_0970
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]961224..964280 [+]
ProductTraU conjugal transfer protein
Component typeTraU_I
UniProt IDC4K530
KEGG IDhde:HDEF_0970
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 9.8e-79, Aligned region: 502..899
Protein Sequence: 1018 a.a.     [Download]
>gi|238898140|ref|YP_002923821.1| TraU conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MIENILTQIESALAAVSLYTLGKDFTAYCDLRTVIGLTQEDKMLRPALQAPYVFVTHTGDYASVFEIQGA
FCEFDEKDTFNERAQKEDPESFRDYIARLHTALASDFKTWGHKLSFVFERDPHKAREELTQLMAPQCRAI
RRCGLDLDDILQEKIEQSVPFMARERAFMVVYTGRTVLPASELKEEQQRLQKRLKGAPVARFGQDPEHLR
LEGLKIRHDALVSKIEQDFSTDGQGVLLRLMEAHEVGFHIREETDRHGTSRDWQPLLPGDLLFPHGRPKG
DDHSTMVPPYLNFQLFSQEVNTHGALVEIDGLWHSSLALTLGPQKPDTFTPLFHKIHRKVPFRLRWDLMP
CGHEVLGKKRTALEFLSVIPSLRPLYDSVQWLAKNNERDPTCVMTITASTWADDPQGVKRNLTLLQKAVQ
SWGVCEVTRTFGDPLRAWTSTILAASSAGGVHLLFPPLSAALAMMPLNRPATPWPNEASVVFQTVDGKPF
PVRLGSALQEKCTEMVTGEPGSGKSVLLNVLNEVVISHGQSQLPFLSIIDKGYSAQGLIRLIRDALPPER
RNEVIGIVLQNDAEQCRNPFDIQLGARFPLTTERSWLIQLCTALCTDPTTGHPPDAKDTQQILSRVIDEV
YRNNAEKNPIRYAPTLVPEVDTALSEIDSPEEWESFSWYEVRDRLFETGHIKEATLAQYQAVPELTDLQS
ALNHEDVRHAFGDIHRDGSQEKLLKTLSRCLTQASTEYRLLAGRTKFALDPNTRVIALDLNNVMGDNTNE
GQLRTGILYLFAGQVAGGEYSLPQHREELLAKIDPRYQDFHLARLEQLDQEMKTKVYDELHNARKVPFIF
SALETQDREQRKFGIRTLLSSQYLSDFPPDLLKSANSLYLMRVRPEDAKILTEHFQVPAATIRRFMSLSK
GAAPDGSGTCFLAVFRTKIGRIVHILKNTVGPRELWALNSTPKDSALRNRLYEQLDGRTARNILAEHFPT
GSAEKIIEHRQKQAGEQESTNIIRQLADELMSSRGPRW
 
Nucleotide Sequence: 3057 bp     [Download]
>gi|238897251|ref|NC_012751.1|:961224-964280 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGATTGAAAACATCCTGACTCAGATTGAATCGGCGCTCGCGGCCGTCTCTCTCTACACCTTAGGGAAAG
ATTTCACTGCTTATTGTGATTTACGCACCGTGATTGGTTTAACCCAGGAAGATAAAATGCTTCGGCCGGC
CCTTCAGGCCCCTTACGTTTTTGTCACCCACACAGGCGATTACGCCAGTGTCTTCGAGATACAGGGGGCT
TTTTGTGAGTTCGATGAAAAAGACACCTTTAACGAGCGGGCTCAAAAAGAAGACCCAGAGTCTTTTCGTG
ATTATATTGCGCGATTACATACGGCGCTGGCCAGCGATTTTAAAACTTGGGGCCATAAACTCAGCTTTGT
CTTTGAGCGCGATCCCCATAAAGCCAGAGAAGAATTAACTCAGCTGATGGCCCCCCAATGTCGTGCCATC
CGACGTTGTGGCCTCGATCTGGACGATATTCTCCAAGAGAAAATAGAACAATCGGTGCCTTTTATGGCAC
GGGAACGCGCTTTTATGGTGGTGTATACCGGGCGGACAGTCTTGCCGGCCTCAGAGCTTAAAGAAGAGCA
ACAACGCCTTCAAAAACGACTCAAAGGGGCCCCTGTCGCGCGTTTTGGACAAGATCCCGAACATTTGCGT
CTGGAAGGACTTAAAATTCGGCATGATGCATTGGTGAGTAAAATAGAACAGGATTTTTCGACGGACGGTC
AAGGCGTCTTACTGAGATTGATGGAAGCCCATGAAGTGGGATTCCATATCCGGGAAGAAACTGATCGCCA
TGGCACATCACGTGACTGGCAACCTCTCTTGCCCGGAGATCTCCTGTTTCCCCATGGGAGACCCAAAGGC
GACGATCACAGTACCATGGTGCCGCCTTACTTGAATTTTCAGCTGTTTTCACAAGAAGTGAACACCCACG
GAGCTTTGGTTGAAATCGACGGGCTTTGGCACAGCAGCCTGGCCTTAACCCTGGGGCCCCAAAAACCCGA
CACCTTCACGCCACTTTTTCACAAAATTCATCGCAAAGTGCCCTTTCGGTTACGATGGGATCTGATGCCC
TGCGGCCATGAAGTGTTAGGAAAAAAACGCACTGCCCTGGAGTTTCTCTCCGTGATCCCCTCATTGCGCC
CACTCTATGATTCTGTCCAGTGGCTGGCGAAAAATAATGAGCGGGATCCGACCTGTGTGATGACCATCAC
AGCCAGTACCTGGGCGGATGATCCCCAGGGCGTCAAAAGAAACCTCACCCTGTTACAAAAAGCGGTCCAA
TCCTGGGGCGTCTGCGAGGTCACTCGCACTTTTGGCGATCCGCTACGGGCTTGGACGTCCACTATTTTAG
CCGCTTCTTCTGCCGGTGGGGTGCATTTGCTCTTTCCGCCCTTGTCGGCGGCACTGGCCATGATGCCGTT
GAACCGGCCTGCCACACCCTGGCCCAATGAAGCCAGTGTGGTCTTTCAGACCGTCGATGGGAAACCCTTT
CCTGTGCGTCTGGGGAGCGCTCTTCAAGAAAAATGTACAGAAATGGTGACGGGAGAACCCGGATCTGGTA
AATCGGTCTTACTCAATGTCCTCAACGAAGTGGTGATCAGCCATGGACAGAGCCAGTTGCCTTTTTTGAG
CATCATCGACAAAGGCTACAGCGCGCAAGGTCTCATCCGATTGATCCGGGATGCCCTGCCACCGGAGCGC
CGAAATGAAGTGATCGGGATCGTTTTACAAAATGACGCCGAGCAGTGCCGCAATCCTTTTGATATCCAGT
TAGGGGCACGATTCCCATTAACCACAGAGCGAAGTTGGCTGATCCAGCTGTGTACGGCCCTGTGTACCGA
TCCTACGACAGGCCATCCTCCTGATGCCAAAGACACGCAGCAGATTTTAAGCCGCGTGATTGATGAAGTG
TATCGCAACAATGCAGAAAAAAACCCGATCCGATATGCCCCGACTTTGGTGCCTGAAGTAGATACCGCAC
TGTCAGAGATCGACTCCCCTGAAGAATGGGAGAGTTTTTCCTGGTATGAGGTCAGAGACAGGTTGTTTGA
AACAGGTCACATCAAGGAGGCCACCCTGGCGCAATACCAGGCCGTCCCCGAGCTGACGGACTTGCAAAGT
GCCCTCAATCACGAAGATGTGCGTCATGCCTTTGGGGATATTCATCGAGACGGATCGCAGGAAAAGTTGC
TTAAAACCCTTTCACGGTGCCTGACCCAGGCCAGCACAGAATATCGCCTGCTGGCAGGACGAACGAAGTT
TGCACTCGATCCCAATACGCGTGTGATCGCCCTCGATCTCAATAACGTGATGGGGGATAACACGAATGAA
GGGCAATTACGCACCGGTATCCTCTATCTGTTTGCAGGACAGGTGGCGGGCGGAGAGTATAGTTTGCCTC
AACATCGGGAAGAGCTCCTGGCCAAAATCGATCCGCGCTATCAAGATTTTCATCTGGCTCGGTTGGAGCA
ACTTGATCAAGAAATGAAAACCAAGGTGTACGATGAATTGCACAATGCCCGAAAAGTCCCTTTCATTTTT
AGCGCGCTGGAAACCCAGGACCGGGAACAACGAAAATTCGGGATCCGAACCCTGCTCTCTTCCCAATATC
TGAGCGATTTTCCGCCGGATTTACTCAAATCGGCGAACTCTCTGTATCTGATGCGCGTGAGGCCCGAAGA
CGCCAAAATACTCACCGAGCATTTTCAGGTGCCCGCGGCCACAATACGGCGGTTTATGAGCCTGAGTAAA
GGCGCGGCCCCCGATGGCAGCGGCACCTGCTTTTTGGCGGTTTTTCGCACCAAAATAGGTAGGATTGTGC
ACATTCTGAAAAACACCGTGGGGCCCAGAGAACTCTGGGCGCTCAATTCCACCCCCAAAGACAGTGCCCT
GAGAAACAGGTTGTACGAACAACTCGATGGCCGCACGGCTCGAAATATTTTAGCGGAACATTTTCCCACA
GGCAGTGCAGAAAAAATCATCGAACACCGGCAAAAACAGGCGGGAGAACAAGAGAGCACCAACATCATTC
GACAACTGGCCGATGAGCTGATGTCCAGCAGAGGCCCCCGATGGTAA
 Primer design