SecReT4
Protein ID: 238898446
T4SS name [ID]VirB [438]
Gene symboltriG
Locus tagHDEF_1338
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]1244785..1245477 [+]
ProductTriG conjugal transfer protein
Component typeVirB8
UniProt IDC4K5Y6
KEGG IDhde:HDEF_1338
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.4e-49, Aligned region: 13..227
Protein Sequence: 230 a.a.     [Download]
>gi|238898446|ref|YP_002924127.1| TriG conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MFTKKEAYLKTAQGFELKWRQRDKRDKTIAFIIAGVGTAFGLLSLIAMIILLPLKQTNTELYVADKLAGT
VEKVTTVEKGELSENSALARYFTQQYVRLREGYDYFRLQHDYDTVQRYGNEAVNKAYLDWWNSPSAPDKV
FKDAEYTAEITFITHFISDSSNPDNTDLLATLRFRKDIRDVRSGHVQPEYWTVRMTWRFEPQQAMTDAQR
AHNPLGFVVTSYQREKEQGE
 
Nucleotide Sequence: 693 bp     [Download]
>gi|238897251|ref|NC_012751.1|:1244785-1245477 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGTTCACTAAAAAAGAAGCGTATTTAAAAACCGCGCAAGGATTTGAATTAAAATGGCGGCAACGTGATA
AACGCGATAAAACCATCGCCTTTATTATCGCGGGTGTTGGCACCGCCTTTGGTCTGCTTTCACTTATCGC
CATGATTATTCTGTTGCCGTTAAAGCAGACCAATACCGAACTTTATGTCGCGGATAAACTGGCGGGCACG
GTAGAAAAAGTCACCACCGTGGAAAAAGGGGAATTATCCGAAAATAGTGCGCTCGCACGGTATTTTACCC
AGCAATATGTGCGCTTGCGGGAAGGGTATGATTATTTTCGTCTGCAACATGATTACGACACGGTACAGCG
CTACGGTAATGAGGCAGTTAACAAAGCCTACCTTGATTGGTGGAATAGCCCGTCTGCACCCGACAAGGTG
TTTAAGGATGCAGAATATACCGCTGAAATCACCTTTATTACCCATTTCATTTCCGATTCCAGCAATCCTG
ATAACACCGATTTACTGGCTACTCTTCGTTTTCGCAAGGATATCCGCGATGTCCGTAGCGGTCATGTGCA
ACCGGAATACTGGACGGTACGCATGACGTGGCGATTCGAGCCACAGCAAGCCATGACCGATGCGCAACGC
GCCCATAATCCGCTGGGATTTGTCGTCACCAGTTATCAGCGTGAAAAAGAGCAGGGGGAATAG
 Primer design