SecReT4
Protein ID: 238898449
T4SS name [ID]VirB [438]
Gene symboltriJ
Locus tagHDEF_1341
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]1247782..1248813 [+]
ProductTriJ conjugal transfer protein
Component typeVirB11
UniProt IDC4K5Y9
KEGG IDhde:HDEF_1341
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-48, Aligned region: 18..278
Protein Sequence: 343 a.a.     [Download]
>gi|238898449|ref|YP_002924130.1| TriJ conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MSHPQNPTMMYYRDSLFGALLATEGLTELAVNRPNQIFTKVNGEWQEHDATLSYEECMTFAAVLANHNDD
HIDDLKPILSATLESGERCQIVIPPACERGTVSITLRQPSYLKIPHQSWIESGFYDQLTGQEKTESHDDV
LIRLFKDNAFPEFMEKAIEYGKTTVFGGGTGSGKTTYEKTLLDCIPSHLRLISIEDNPEVEFYSHRNYVH
LFYNAEAPEGAIVTPASLLRANFRMNPDRILLTEVRGPETWDFMKAQSSGHEGGVTSLHAPTPEAVIDGI
IERCYQNPECRNLPYNVMLRKVLNNIDVIACMTARGNWRRLTQLYFKPLHRDSYFKELSRGQM
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|238897251|ref|NC_012751.1|:1247782-1248813 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGAGTCACCCCCAAAATCCAACGATGATGTATTACCGCGATAGTCTCTTTGGCGCATTACTGGCGACAG
AGGGGTTAACCGAACTGGCGGTCAACCGACCGAACCAGATTTTTACCAAGGTCAATGGGGAATGGCAGGA
GCATGACGCGACGCTAAGCTATGAGGAATGCATGACCTTTGCCGCGGTGCTGGCAAACCACAATGACGAC
CACATTGATGATCTGAAACCGATATTATCCGCCACGCTGGAAAGCGGAGAACGTTGCCAGATCGTGATCC
CCCCGGCCTGTGAGCGTGGCACCGTGTCGATCACCCTCCGTCAACCGTCTTACCTGAAAATTCCTCACCA
GTCCTGGATCGAGAGCGGTTTTTACGACCAACTGACCGGACAGGAAAAAACAGAGAGTCACGATGACGTT
TTGATACGGCTGTTTAAGGATAACGCCTTTCCCGAATTTATGGAAAAGGCGATCGAATACGGCAAGACAA
CCGTGTTTGGCGGCGGAACCGGTTCAGGCAAAACCACCTATGAAAAAACGTTGCTCGACTGTATCCCGTC
GCATTTACGGCTTATCTCCATTGAAGATAACCCGGAGGTGGAATTCTATTCACATCGTAACTATGTTCAC
CTGTTTTATAACGCCGAAGCCCCGGAAGGGGCCATTGTCACCCCTGCCAGCCTGCTCCGCGCCAATTTTC
GCATGAATCCCGACCGCATCCTGCTGACAGAGGTACGCGGCCCGGAAACATGGGATTTTATGAAAGCGCA
AAGCTCCGGGCATGAAGGCGGTGTCACCAGCCTCCATGCGCCAACGCCGGAAGCGGTGATTGATGGCATT
ATCGAACGCTGTTACCAGAACCCGGAGTGCCGCAACCTGCCTTATAACGTGATGCTGCGCAAGGTGCTTA
ACAACATCGATGTGATCGCCTGCATGACGGCACGGGGTAACTGGCGGCGGCTGACGCAGCTTTATTTCAA
GCCGCTTCATCGTGATAGCTATTTTAAGGAATTAAGTCGTGGACAAATGTAA
 Primer design