SecReT4
Protein ID: 238898450
T4SS name [ID]VirB [438]
Gene symboltaxB
Locus tagHDEF_1342
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]1248800..1250653 [+]
ProductTaxB conjugal transfer protein
Component typeVirD4
UniProt IDC4K5Z0
KEGG IDhde:HDEF_1342
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.4e-114, Aligned region: 102..581
TraG-D_C [PF12696], Evalue: 4.4e-25, Aligned region: 423..542
TrwB_AAD_bind [PF10412], Evalue: 1.2e-19, Aligned region: 377..556
Protein Sequence: 617 a.a.     [Download]
>gi|238898450|ref|YP_002924131.1| TaxB conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MDKCKLTPGQWGFIGLLVCLLTVGIASVLVYPMNGVGLRRFLQTYQFSILGRILFDSDIRDDIRWNAVLS
LLYGFLASGVIAGALIIKTAMQKPSLYGDAKFASDADIRRSKAVTWGDESKGGVIIGRYKGKLLRYIAPD
FISMGAGTRAGKGAAMVIPNLLAWLFSVIVLDPKQECYKITSQFRQLIMGQKVYLLDPFSSKTHGFNPLF
YIDLSHEKGSGYLLNLAETLWNASGLTGTEAHFNSAAGRVFIGYTQLLYTLINHGREYLAKYDIKPVFSI
GTVLDLYYAVNRESLLANGDESQCPSIRERVANSGNQREQYLLRDAFNKIKEYNDLGDEPRSSTEGTFLK
KLNLFTLPLFRKATDRNDFDLRLLRKERMTIYLGINADDLKIADDFLNLFFNLAIDVSMRENPDFETDNK
HDVLFLLDEFPAIGAMHYIKKASGFIAGFKLKLLTIYQNISQLIEIYGEMGAKTLLSGHPCRVIYAVSEK
EDADKFSAQLGYTTTKSTGKSRNRNKGSVSQGESENEAQRALVLPQELGTLKFQEEFILLKGENPIKCEK
ALYFNDPYFMDRLCAVSPKLRARVASMNNGSSMVKKGLKYPPKEEMLSLGELEAELF
 
Nucleotide Sequence: 1854 bp     [Download]
>gi|238897251|ref|NC_012751.1|:1248800-1250653 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
GTGGACAAATGTAAACTCACGCCGGGGCAATGGGGTTTTATTGGCCTTCTGGTCTGCCTGCTGACGGTGG
GGATAGCGAGTGTGCTGGTTTATCCCATGAACGGCGTAGGACTGCGCCGCTTTTTACAGACATACCAGTT
TTCGATACTGGGGCGCATCCTGTTTGATAGCGATATTCGTGATGATATTCGCTGGAATGCCGTGTTGTCG
CTGCTGTATGGTTTTCTCGCCTCAGGGGTGATAGCGGGCGCGCTGATTATCAAAACGGCGATGCAAAAGC
CCTCGCTTTACGGTGACGCAAAATTTGCCAGCGATGCCGATATTCGCCGCTCCAAAGCGGTGACGTGGGG
CGATGAAAGCAAAGGCGGCGTCATTATCGGACGTTACAAGGGCAAGCTGCTTCGCTATATCGCGCCTGAC
TTTATCTCAATGGGGGCGGGGACACGCGCCGGGAAAGGGGCCGCCATGGTTATCCCTAATCTGCTGGCGT
GGCTGTTTTCGGTGATTGTGCTCGACCCCAAGCAGGAGTGTTACAAAATCACCAGTCAATTCCGGCAGCT
TATCATGGGGCAAAAAGTCTATTTGCTTGACCCGTTTTCCAGCAAGACACACGGTTTTAACCCGCTGTTT
TATATTGATTTATCCCATGAGAAAGGCTCCGGATATCTGCTTAATCTGGCGGAAACCCTGTGGAATGCAT
CAGGACTGACCGGGACGGAAGCGCACTTTAACAGCGCCGCCGGGCGCGTCTTTATCGGCTATACGCAGTT
GTTGTATACGTTAATCAATCACGGTCGGGAATATTTAGCGAAATATGATATTAAACCGGTGTTTTCCATT
GGGACAGTGCTTGACCTGTACTATGCCGTGAACCGTGAGTCATTGCTGGCAAACGGCGACGAAAGCCAGT
GCCCCAGTATCCGCGAACGGGTAGCCAATAGCGGAAATCAACGTGAGCAATACCTGCTCAGGGATGCGTT
CAACAAAATCAAGGAATATAATGACCTGGGTGACGAGCCTCGCTCCAGCACCGAAGGCACCTTTCTTAAA
AAATTAAACCTGTTCACCTTACCGCTCTTTCGCAAAGCCACTGACCGCAACGATTTTGATTTACGGTTGT
TGCGTAAAGAACGCATGACCATTTACTTAGGGATTAATGCCGACGATTTGAAGATTGCCGATGATTTTTT
AAATCTGTTCTTCAACTTGGCGATTGACGTCAGTATGCGCGAAAATCCCGATTTTGAAACAGATAATAAA
CATGACGTACTGTTTCTGCTTGATGAGTTTCCCGCGATTGGTGCCATGCACTACATTAAAAAGGCATCCG
GGTTTATTGCCGGATTTAAACTCAAATTACTCACCATCTACCAGAATATTTCACAACTGATTGAGATTTA
CGGTGAGATGGGGGCAAAAACATTGCTGTCCGGTCATCCCTGCCGGGTGATTTATGCGGTCAGCGAAAAA
GAAGACGCTGACAAATTTTCCGCGCAATTAGGCTATACCACCACCAAATCAACCGGAAAAAGCCGAAACC
GTAATAAAGGCAGCGTATCACAAGGCGAATCCGAGAACGAAGCCCAACGCGCGCTGGTGTTACCGCAAGA
ATTGGGGACACTGAAATTTCAGGAGGAGTTTATTCTGCTGAAAGGCGAGAACCCGATTAAATGCGAAAAG
GCACTGTATTTTAATGACCCGTATTTTATGGACAGACTGTGTGCGGTGTCACCGAAGCTGAGAGCGCGTG
TGGCCAGCATGAACAATGGCTCATCAATGGTTAAAAAGGGACTGAAATATCCCCCAAAAGAAGAGATGTT
GTCATTAGGGGAACTTGAAGCAGAGCTCTTTTAA
 Primer design