SecReT4
Protein ID: 238899368
T4SS name [ID]Tra_I [176]
Gene symboltraU
Locus tagHDEF_p0027
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconplasmid pHD5AT [GenBank: NC_012752] [Browse all T4SS(s) in this replicon]
Location [Strand]29286..32375 [-]
ProductTraU conjugal transfer protein
Component typeTraU_I
UniProt IDC3M8D2
KEGG IDhde:HDEF_p0027
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.3e-78, Aligned region: 513..910
Protein Sequence: 1029 a.a.     [Download]
>gi|238899368|ref|YP_002925051.1| TraU conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MNFIISDWIITMIEKILTQIESALAAVSRYTLGKDFTAYCDLRTVIGLTEEDKMLRPALQAPYIFVTHTG
DYASVFEIQGAFCEFDEKDTFNERVQKEDPESFRDYIARLHTALASDFKSWGHKLSFVFERDPHKAREEL
TQLMAPQCRAIRRCGLALEDILQEKIEHSVPFMARERAFMVVYTGRTVLPASELKEEQQRLQTRLNGAPV
ARFGQDPEHLRLEGLKIRHDALLSKIEQDFSTDGQGVLLRLMEAHEVGFHIREETDRHGTSRDWQPLLPG
DLLFPHGRPKGDDHSTMVPPYLNFQLFSQEVNTHGALVEIDGLWHSSLALTLGPQKPETFTQLFHKIHRK
VPFRIRWDLMPCGHDVLGKXRTALEFLSVIPSLRPLYDSVQWLAKNNERDPTCVMTITASTWADDPQGVK
RNLTMLQKAVQSWGVCEVTRTFGDPLRAWTSTILAASSAGGVHLLFPPLSAALAMMPLNRPATPWPNEAS
VVFQTIDGKPFPVRLGSALQEKCTEMVTGEPGSGKSVLLNVLNEVVISHGQSQLPFLSIIDKGYSAQGLI
RLIRDALPPERRNEVIGIVLQNDDQQCRNPFDIQLGARFPLTTERSWLIQLCTALCTDPTTGHPPNAKDT
QQILSRVIDEVYRNNAEKNPIRYAPTLVPEVDTALSEIDSPEEWESFSWYEVRDRLFETGHIKEATLAQY
QAVPELTDLQSALNHEDVRHAFGDIHRDGSQEKLLKTLSRCLTQASTEYRLLAGRTKFSLDPNTRVIALD
LNNVMGDNTNEGQLRTGILYLFAGQVAGGEYSLPQHREELLAKIDPRYRNFHLARLEQLDQEMKTKVYDE
LHNARKVPFIFSALETQDREQRKFGIRTLLSSQYLSDFPPDLLKSANSLYLMRVRPEDAKILTEHFQVPA
ATLRRFMSLSKGAAPDGSGTCFLAVFRTKIGRIVHILKNTVGPRELWALNSTPKDSALRNRLYEQLDGRT
ARNILAEHFPTGSAEKIIEHRQKQAGEQESTNIIRQLADELMSSRGSRW
 
Nucleotide Sequence: 3090 bp     [Download]
>gi|238899346|ref|NC_012752.1|:c32375-29286 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) plasmid pHD5AT, complete sequence
ATGAATTTTATTATCTCTGATTGGATTATCACCATGATTGAAAAAATCCTCACACAGATTGAATCTGCAC
TCGCCGCCGTCTCTCGCTACACCTTAGGGAAAGATTTCACTGCTTATTGTGATCTGCGTACCGTGATTGG
TTTAACAGAAGAAGACAAAATGCTTCGACCTGCCTTGCAAGCCCCTTACATTTTTGTCACCCACACAGGC
GATTACGCCAGTGTCTTCGAGATACAGGGGGCTTTTTGTGAGTTCGATGAAAAAGACACCTTTAACGAGC
GGGTTCAAAAAGAAGACCCAGAGTCTTTTCGGGATTATATTGCGCGATTACATACAGCGCTGGCCAGCGA
TTTTAAAAGTTGGGGCCATAAACTCAGCTTTGTCTTTGAGCGCGATCCCCATAAAGCCAGAGAAGAATTA
ACTCAGCTGATGGCCCCCCAATGTCGTGCCATCCGACGTTGTGGCCTCGCTCTCGAAGATATTTTGCAAG
AAAAAATAGAACACTCGGTGCCCTTTATGGCACGGGAACGCGCTTTTATGGTGGTGTATACAGGGCGTAC
AGTATTGCCGGCCTCAGAGCTTAAAGAAGAGCAACAACGCCTTCAAACACGACTCAATGGGGCCCCTGTC
GCGCGTTTTGGACAAGATCCCGAACATTTGCGTCTGGAAGGACTTAAAATTCGGCATGATGCCCTCCTGA
GTAAAATAGAACAGGATTTTTCGACGGACGGTCAAGGCGTTTTACTGAGATTGATGGAAGCCCATGAAGT
GGGATTCCATATCCGGGAAGAAACGGATCGCCATGGCACATCCCGTGACTGGCAACCTCTCTTGCCCGGA
GATCTCCTGTTTCCCCATGGGAGACCCAAAGGCGACGATCACAGTACCATGGTGCCGCCTTACTTAAATT
TTCAGCTGTTTTCACAAGAAGTGAACACCCACGGAGCTTTGGTTGAAATCGACGGGCTTTGGCACAGCAG
CCTGGCCTTAACCCTGGGGCCCCAAAAACCGGAAACCTTCACCCAACTTTTTCACAAAATTCATCGCAAA
GTCCCCTTTCGGATACGATGGGATCTGATGCCCTGCGGCCATGACGTGTTAGGAAAAAANCGCACTGCCT
TAGAGTTTCTCTCCGTGATCCCCTCATTGCGCCCACTCTATGATTCTGTCCAGTGGCTGGCGAAAAATAA
TGAGCGAGATCCGACCTGTGTGATGACCATCACAGCCAGTACCTGGGCGGATGATCCCCAGGGCGTCAAA
AGAAACCTCACCATGCTCCAAAAAGCGGTCCAATCCTGGGGCGTCTGCGAGGTCACTCGAACTTTTGGGG
ATCCCCTACGGGCTTGGACGTCTACTATTTTAGCCGCTTCTTCTGCCGGTGGGGTGCATTTGCTTTTTCC
GCCCTTGTCGGCGGCACTGGCCATGATGCCGTTGAACCGGCCTGCCACACCCTGGCCCAATGAAGCCAGT
GTGGTCTTTCAAACCATCGATGGGAAACCCTTTCCTGTGCGGCTGGGGAGCGCTCTTCAAGAAAAATGTA
CAGAAATGGTGACGGGAGAACCCGGATCTGGTAAATCGGTCTTACTCAATGTCCTCAACGAAGTGGTGAT
CAGCCATGGACAGAGCCAGTTGCCTTTTTTGAGCATCATCGACAAAGGCTACAGCGCGCAAGGTCTCATC
CGATTGATCCGGGATGCCCTGCCACCGGAGCGCCGAAATGAAGTGATCGGGATCGTTTTACAAAATGACG
ACCAGCAGTGCCGCAATCCTTTTGATATCCAGCTGGGGGCCCGATTCCCATTAACCACAGAGCGAAGTTG
GCTGATCCAGCTGTGTACCGCCCTGTGTACCGATCCTACGACAGGCCATCCCCCTAATGCCAAAGACACC
CAGCAGATTTTAAGCCGCGTGATTGATGAGGTGTATCGCAACAATGCAGAAAAAAACCCGATCCGATATG
CCCCGACTTTGGTGCCTGAAGTAGATACCGCACTATCAGAGATCGACTCCCCTGAAGAATGGGAGAGTTT
TTCCTGGTATGAGGTCAGAGACAGGTTGTTTGAAACAGGTCATATCAAGGAGGCCACCCTGGCGCAATAC
CAGGCCGTCCCAGAGCTGACGGACTTGCAAAGTGCCCTCAATCACGAAGATGTCCGTCATGCCTTTGGGG
ATATTCATCGAGACGGATCGCAGGAAAAGTTGCTTAAAACCCTTTCACGGTGCCTGACCCAGGCCAGCAC
AGAATATCGCCTGCTGGCAGGACGCACGAAGTTTTCACTCGATCCCAATACGCGGGTGATCGCCCTCGAT
CTCAATAACGTGATGGGGGATAACACGAATGAAGGGCAATTACGCACGGGGATCCTCTATCTGTTTGCAG
GACAGGTGGCGGGCGGAGAGTATAGTTTGCCTCAACATCGGGAAGAGCTCTTGGCCAAAATCGATCCGCG
CTATAGAAATTTTCATCTGGCTCGGTTAGAACAACTTGATCAAGAAATGAAAACCAAGGTGTACGATGAA
TTGCACAATGCCCGAAAAGTCCCTTTCATTTTTAGCGCGCTGGAAACCCAGGACCGGGAACAACGAAAAT
TTGGGATCCGAACCCTGCTCTCTTCCCAATATCTGAGCGATTTTCCGCCGGATTTACTCAAATCGGCGAA
CTCTCTGTATCTGATGCGCGTGAGGCCCGAAGACGCCAAAATACTCACCGAGCATTTTCAGGTGCCCGCG
GCCACCCTCCGGCGTTTTATGAGCCTGAGCAAAGGGGCCGCCCCCGATGGCAGCGGCACCTGCTTTTTGG
CCGTCTTTCGCACCAAAATAGGCCGCATTGTGCACATTCTGAAAAACACCGTGGGGCCCAGAGAACTCTG
GGCGCTCAATTCCACCCCCAAAGACAGTGCCCTGAGAAACAGGTTGTACGAACAACTCGATGGCCGCACG
GCTCGAAATATTTTAGCGGAACATTTTCCCACAGGCAGTGCAGAAAAAATCATCGAACACCGACAAAAAC
AGGCGGGAGAACAAGAGAGCACCAACATCATTCGACAACTGGCCGATGAGCTGATGTCCAGCAGAGGCTC
CCGATGGTAA
 Primer design