SecReT4
Protein ID: 238899377
T4SS name [ID]Tra_I [176]
Gene symboltraM
Locus tagHDEF_p0035
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconplasmid pHD5AT [GenBank: NC_012752] [Browse all T4SS(s) in this replicon]
Location [Strand]37611..38282 [-]
ProductTraM conjugal transfer protein
Component typeTraM_I
UniProt IDC3M8E1
KEGG IDhde:HDEF_p0035
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 9.8e-31, Aligned region: 74..180
Protein Sequence: 223 a.a.     [Download]
>gi|238899377|ref|YP_002925060.1| TraM conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MKKNSDLGDNKDNAPYKAALELHHQNQLGAQFARTTLTLCLTTSLCLIVSLLLNGYLGWTVAHPPVKYFA
TQEGRVIPLIPTHQPVLTVSQVSDFGAHTIREAFTMDFVHFKEQMSRVSAYFSEEGFKSYYQALTQSNVL
AAVRDKKMNLAVMLAPGVVRQKGPLSNGVYAWEIQYPVTLKLSGQTLSLPEQRFIFSLFLQRADLREKPN
GLEVTQLVTFDAK
 
Nucleotide Sequence: 672 bp     [Download]
>gi|238899346|ref|NC_012752.1|:c38282-37611 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) plasmid pHD5AT, complete sequence
ATGAAAAAAAATTCCGACCTGGGTGATAATAAGGACAATGCTCCTTACAAAGCGGCTCTTGAGCTCCATC
ATCAAAATCAACTGGGGGCTCAATTTGCCCGAACCACATTAACACTCTGCCTGACAACCAGCCTGTGTCT
CATCGTGTCGCTTCTGCTCAATGGCTATTTAGGCTGGACAGTGGCGCATCCCCCCGTCAAATACTTTGCG
ACACAGGAAGGACGAGTGATCCCACTCATCCCAACACATCAACCGGTGTTGACGGTATCTCAAGTGTCAG
ATTTTGGCGCTCACACCATCCGGGAAGCCTTCACCATGGATTTTGTGCATTTTAAGGAGCAAATGAGCCG
GGTTTCAGCTTATTTTTCAGAAGAAGGATTTAAAAGTTATTACCAGGCGTTGACACAATCGAACGTCTTA
GCGGCCGTTCGAGACAAAAAAATGAATCTGGCCGTCATGTTAGCGCCCGGCGTCGTTCGCCAAAAAGGGC
CTTTGTCCAATGGCGTCTATGCGTGGGAAATCCAGTATCCCGTGACATTAAAACTCTCAGGACAGACGCT
GTCTCTACCCGAGCAACGCTTTATTTTTTCTCTCTTTCTGCAACGCGCCGATCTGAGAGAAAAACCCAAT
GGACTGGAAGTGACTCAATTAGTCACCTTTGATGCGAAATGA
 Primer design