SecReT4
Protein ID: 238899378
T4SS name [ID]Tra_I [176]
Gene symboltraL
Locus tagHDEF_p0036
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconplasmid pHD5AT [GenBank: NC_012752] [Browse all T4SS(s) in this replicon]
Location [Strand]38307..38696 [-]
ProductTraL conjugal transfer protein
Component typeTraL_I
UniProt IDC3M8E2
KEGG IDhde:HDEF_p0036
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 129 a.a.     [Download]
>gi|238899378|ref|YP_002925061.1| TraL conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MISLFTQAEPCRAHQAAQIGSQMGYEQAKKAADAWEKREQYATTALQQCLGSLSTSLTVPTFPDLSSLLN
GIKDKVCAAGREKISRVIPSHINPWEEWTVADYSIPKKTVSASQMMVPEPKKGSPFTLN
 
Nucleotide Sequence: 390 bp     [Download]
>gi|238899346|ref|NC_012752.1|:c38696-38307 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) plasmid pHD5AT, complete sequence
ATGATCAGCCTCTTCACTCAAGCCGAGCCCTGTCGCGCACATCAAGCGGCTCAAATCGGCAGTCAAATGG
GGTATGAGCAGGCCAAAAAAGCGGCCGATGCCTGGGAAAAACGGGAACAGTACGCCACCACCGCATTACA
GCAATGTTTAGGCAGCCTCAGTACCTCGCTCACCGTCCCGACCTTTCCTGACCTGTCGAGCCTCTTGAAT
GGCATTAAAGACAAGGTCTGTGCGGCGGGTCGAGAAAAAATCTCCCGTGTTATCCCGAGCCACATCAATC
CTTGGGAAGAATGGACAGTGGCGGACTATTCAATCCCCAAAAAAACGGTCTCCGCTTCACAAATGATGGT
CCCTGAGCCAAAAAAGGGATCTCCTTTTACGCTCAATTAA
 Primer design