SecReT4
Protein ID: 238899381
T4SS name [ID]Tra_I [176]
Gene symboltraJ
Locus tagHDEF_p0039
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconplasmid pHD5AT [GenBank: NC_012752] [Browse all T4SS(s) in this replicon]
Location [Strand]41875..43041 [-]
ProductTraJ conjugal transfer protein
Component typeTraJ_I
UniProt IDC3M8E5
KEGG IDhde:HDEF_p0039
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4e-35, Aligned region: 25..307
AAA_23 [PF13476], Evalue: 2e-05, Aligned region: 153..181
Protein Sequence: 388 a.a.     [Download]
>gi|238899381|ref|YP_002925064.1| TraJ conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MTENSLPPFDFSAGLTADTLRRFFAWCASHQVTDIHLQGGAPMMVGRYGRLIKASAFRLEEAQLTKLIDE
IFTPEIKAMVKSGQGVDRALQLEGDANGRYGLPRGERLRFRANFIQATAGRQELTMAVTLRLIPSQIPTL
ESLAIEPELFKNLLPHKGLIWVCGETGSGKSTLLAAIYQYCGRVYPDRKIVTFEDPIEYILGTPENRLPP
TQSQIGRDVSSFSEGLRLALRQAPDVIGVGEIRDGETLMGAIACGQSGHLCLSTLHTHSPAETIPRAVLM
FPPDRREAVAHDLLGILQVIVVQQLLRTTDGQRQAIREYLIFDDAVRQALSELNYTQWSAWINRRLKTQK
ARLADKAWQLYQEDRIADEELLTVMSHSEREGRKKNTL
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|238899346|ref|NC_012752.1|:c43041-41875 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) plasmid pHD5AT, complete sequence
ATGACGGAAAATAGCCTGCCACCCTTTGATTTCAGCGCGGGATTAACGGCAGACACCCTGCGGCGATTTT
TCGCCTGGTGTGCGAGTCACCAGGTCACCGACATTCATCTCCAGGGCGGCGCGCCCATGATGGTCGGCCG
TTACGGGCGATTGATCAAAGCCAGTGCCTTTCGCCTGGAAGAGGCGCAATTAACGAAATTAATCGATGAA
ATCTTTACGCCAGAAATCAAGGCGATGGTGAAATCAGGGCAGGGCGTTGATCGGGCACTCCAGCTCGAGG
GCGATGCGAATGGACGCTACGGATTACCACGAGGAGAACGCCTGAGGTTTCGGGCCAATTTTATTCAAGC
CACGGCGGGACGTCAGGAATTAACCATGGCGGTGACATTAAGGCTCATTCCTTCCCAAATCCCGACACTC
GAGAGTTTGGCCATCGAGCCTGAGTTATTCAAAAACCTGTTGCCCCATAAGGGATTAATCTGGGTGTGTG
GCGAAACCGGCTCGGGGAAATCAACGTTACTGGCGGCCATTTATCAATATTGTGGGCGGGTGTATCCCGA
TAGAAAAATCGTCACCTTCGAAGATCCCATTGAATATATTCTCGGCACGCCAGAAAATCGTTTGCCTCCG
ACCCAATCCCAAATTGGGCGTGACGTGAGCAGCTTTTCGGAAGGACTGAGACTGGCGCTACGCCAGGCGC
CTGATGTCATTGGGGTGGGAGAAATTCGAGATGGGGAGACCTTGATGGGGGCCATTGCCTGCGGTCAGTC
AGGGCATCTGTGTTTGTCTACCTTGCACACCCATTCTCCCGCTGAAACCATTCCCCGAGCGGTCTTGATG
TTTCCCCCAGACAGGCGGGAAGCCGTCGCGCACGATTTGCTGGGAATATTACAGGTCATTGTCGTGCAGC
AGTTATTACGCACCACAGACGGCCAACGCCAGGCCATTCGTGAATATCTCATTTTTGATGACGCCGTGCG
ACAAGCGCTCTCTGAGTTGAATTACACCCAATGGAGCGCATGGATTAACCGACGTTTAAAAACGCAAAAA
GCCCGTTTGGCTGATAAAGCATGGCAATTATATCAGGAAGACCGGATTGCTGACGAAGAGCTCCTCACCG
TCATGAGCCACAGCGAAAGGGAAGGAAGAAAGAAAAATACCCTCTGA
 Primer design