SecReT4
Protein ID: 238918296
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0333
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]336548..337003 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDC5BCW9
KEGG IDeic:NT01EI_0333
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 151 a.a.     [Download]
>gi|238918296|ref|YP_002931810.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MARPWPWTINVAGKEYRYSSRLEAWQALQVFMSRYSLKRIDVGLAQVNLGWNGHHFTSTWAAFDPYTNLN
AAAAILRECWERKPGSWLDAAGCYHHPAGGQAAVRYKTIVKRHLVRISGSIRQSPPPLLPQTIVANAPEP
GFIWTEPGSEP
 
Nucleotide Sequence: 456 bp     [Download]
>gi|238917983|ref|NC_012779.1|:336548-337003 Edwardsiella ictaluri 93-146 chromosome, complete genome
GTGGCCCGTCCCTGGCCGTGGACGATTAACGTGGCAGGTAAGGAATACCGCTACAGTAGTCGTCTAGAGG
CCTGGCAGGCGCTGCAGGTATTTATGTCACGTTATTCCCTTAAACGTATTGATGTCGGTCTGGCGCAAGT
GAATCTGGGCTGGAATGGGCATCACTTTACCTCGACCTGGGCAGCATTCGATCCGTACACCAACCTCAAC
GCTGCTGCGGCCATCCTGCGCGAGTGTTGGGAGCGTAAACCGGGTAGCTGGCTGGATGCGGCCGGTTGCT
ATCACCATCCGGCGGGAGGGCAAGCGGCAGTACGATACAAAACTATTGTAAAACGTCATCTTGTCCGTAT
CAGCGGCTCGATCCGCCAGTCTCCGCCCCCTTTATTACCGCAAACAATAGTGGCCAATGCCCCTGAGCCT
GGTTTTATCTGGACTGAACCTGGGAGTGAGCCCTGA
 Primer design