SecReT4
Protein ID: 238918300
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0337
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]340556..341311 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDC5BCX3
KEGG IDeic:NT01EI_0337
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 7.3e-73, Aligned region: 50..248
Protein Sequence: 251 a.a.     [Download]
>gi|238918300|ref|YP_002931814.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MAELQRNGPPQPRPEKPHDLLYNVFWGWPWALIGMLLGSLMLSLLIEYTGIAFFWPEAGAAHSEAVMNTE
LGWLSTEFTRSLLLSEPSVTVSRWVTTAYQWLFVDSGFTGWIKQHVLQTGSGNELTRNLSSWSGWLAGYL
HEYLTATVWICVITLVRVTILVLSVPLFLMVVLVALVEGLGRRDLRRYGAGYESSFVYHHAKKRVKPAIV
VPIILYLSWPTAVYPNLLLLPAAILLGVAITVTMASFKKYL
 
Nucleotide Sequence: 756 bp     [Download]
>gi|238917983|ref|NC_012779.1|:340556-341311 Edwardsiella ictaluri 93-146 chromosome, complete genome
GTGGCTGAACTTCAGCGTAATGGTCCGCCTCAGCCCCGGCCGGAGAAGCCACATGATCTGCTTTATAATG
TGTTCTGGGGCTGGCCCTGGGCGCTGATCGGCATGCTGCTGGGTTCGCTGATGCTGAGCCTGCTGATTGA
GTACACCGGCATTGCGTTCTTCTGGCCGGAAGCGGGTGCAGCCCACAGCGAGGCGGTGATGAATACCGAA
CTGGGCTGGCTGTCGACAGAATTCACCCGCAGCCTGTTGCTGTCGGAGCCTTCTGTGACTGTTTCCCGGT
GGGTAACAACTGCGTATCAGTGGCTGTTTGTTGACAGTGGGTTTACTGGCTGGATAAAGCAGCATGTGCT
GCAGACGGGCAGCGGTAACGAGCTGACCCGTAATCTGAGCAGCTGGAGTGGGTGGCTTGCGGGCTATCTG
CATGAATATCTGACGGCGACCGTGTGGATATGCGTGATTACCCTGGTGCGGGTGACCATACTGGTTCTGT
CAGTCCCACTGTTTCTGATGGTTGTACTGGTTGCGTTGGTTGAAGGACTGGGGCGCAGGGATCTGCGGCG
CTATGGGGCGGGTTATGAAAGCTCGTTTGTTTATCATCATGCTAAAAAGAGGGTGAAACCAGCGATAGTG
GTGCCCATAATACTGTATCTTTCCTGGCCGACGGCGGTGTACCCTAACCTGCTGTTGTTACCTGCTGCTA
TATTACTGGGTGTCGCCATCACGGTCACCATGGCTTCATTCAAGAAATATCTTTAG
 Primer design