SecReT4
Protein ID: 238918302
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0339
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]342115..342456 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDC5BCX5
KEGG IDeic:NT01EI_0339
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.5e-28, Aligned region: 28..108
Protein Sequence: 113 a.a.     [Download]
>gi|238918302|ref|YP_002931816.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MNHPHPVRSLSARIPGITGLLLLATLSTTVQAAEKDELASALRQLDQVQASLERARVAAAQAAPAEQGRF
FFDYRQATSDLNTIRIGIDRYLEPSRSQPRASFVSGNYRRERP
 
Nucleotide Sequence: 342 bp     [Download]
>gi|238917983|ref|NC_012779.1|:342115-342456 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGAACCATCCTCATCCGGTCCGGAGCCTGAGCGCTCGTATCCCGGGCATCACCGGCCTGCTACTGTTGG
CCACATTGTCCACGACGGTACAAGCGGCAGAAAAAGACGAGCTCGCTTCGGCCTTGCGCCAACTGGATCA
AGTGCAAGCCTCACTTGAACGTGCCCGCGTAGCGGCGGCTCAGGCCGCTCCTGCTGAGCAGGGGCGTTTC
TTTTTTGACTACCGTCAGGCTACATCCGATCTGAATACCATTCGTATCGGTATTGACCGCTATCTGGAGC
CATCCCGGTCCCAACCACGGGCTTCATTTGTTAGCGGTAATTATCGTCGGGAGCGTCCCTGA
 Primer design