SecReT4
Protein ID: 238918305
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0342
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]343121..343477 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDC5BCX8
KEGG IDeic:NT01EI_0342
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.5e-41, Aligned region: 1..114
Protein Sequence: 118 a.a.     [Download]
>gi|238918305|ref|YP_002931819.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MQTIRFLPDRLNSEPVVFRGFTTPEMGLASLAGLGVGLLLSLPFIPLAGWVIIPTGMLLAPLLVIGFGGR
WLSRIKRGKPENYIWQRLEAFKRRHSLGNPTLIIDARGWSLKRTGREK
 
Nucleotide Sequence: 357 bp     [Download]
>gi|238917983|ref|NC_012779.1|:343121-343477 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGCAGACCATTCGCTTTTTACCTGACCGTCTGAACAGTGAACCTGTGGTATTTCGCGGGTTCACCACCC
CGGAGATGGGGCTTGCTTCCCTGGCCGGTCTGGGTGTGGGTCTGCTCCTGTCTTTGCCATTTATCCCTCT
TGCCGGCTGGGTCATTATCCCGACCGGTATGCTACTGGCACCGCTACTGGTTATCGGTTTCGGCGGTCGG
TGGCTGAGCCGCATCAAACGCGGCAAGCCCGAAAACTATATCTGGCAGCGACTGGAGGCGTTCAAACGTC
GTCACAGCCTGGGCAACCCGACTCTGATCATTGATGCCCGGGGATGGTCCCTGAAACGAACCGGGAGAGA
AAAATGA
 Primer design