SecReT4
Protein ID: 238918317
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0354
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]356811..358109 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDC5BDI0
KEGG IDeic:NT01EI_0354
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 432 a.a.     [Download]
>gi|238918317|ref|YP_002931831.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MDGAVSDKLFYTLGGGSVISQPATRSNMKKLGMDIGWSSDLMCGNFDLKTTVGNQLNGVTDGFKNLMGDV
IQGATGAVASLPAMLIQRANPGLYDMLTNGVLQANVSFDKAQLNCQNMAKKMMDFSDTSKWTQAAMAEEY
KSLVNNGETDAIRADQKYQDADGTSGKKWIGGQIRGGKGQKAIRPTYDLVSAGYNMMNSLNVLSSETVSG
ASCNGGACSKFSNAEEAAQAVVRVLGDRSMRTCSNALQCTSGDTDDQPGLSVAGTGFAPMLEEATKNNTE
QLVKLVNGTVKPTATELAKLKTGGLPVTANVIRALQRDPDNTALTVRLASELAMSDAVETALLMRRMLTT
GMSEPNAQDQPLALEDGVHRIDALDREIMALKNEMDLKRELARNSVLTIIERDNERVGTNPMIQQTDNAD
SRFQKLDTPDAE
 
Nucleotide Sequence: 1299 bp     [Download]
>gi|238917983|ref|NC_012779.1|:356811-358109 Edwardsiella ictaluri 93-146 chromosome, complete genome
GTGGATGGCGCTGTCTCCGACAAGTTGTTTTATACCTTGGGCGGTGGGTCGGTGATATCGCAGCCGGCGA
CGCGCAGCAATATGAAAAAACTGGGAATGGATATTGGGTGGAGCAGTGACCTGATGTGCGGCAACTTCGA
CCTTAAAACCACTGTTGGCAATCAGCTGAATGGGGTGACAGACGGATTTAAGAATCTTATGGGCGACGTT
ATCCAGGGGGCTACCGGTGCGGTCGCCAGCCTGCCGGCGATGCTTATTCAGCGGGCCAATCCGGGCCTGT
ATGACATGCTGACCAATGGGGTGCTGCAGGCAAATGTGTCCTTCGACAAGGCGCAACTGAACTGTCAGAA
CATGGCGAAGAAAATGATGGATTTCAGTGATACCAGCAAGTGGACCCAGGCAGCTATGGCGGAAGAGTAT
AAATCGCTGGTCAACAATGGAGAAACAGACGCAATACGTGCGGATCAAAAATATCAGGATGCTGACGGAA
CCTCCGGGAAAAAATGGATTGGTGGTCAGATTAGAGGAGGAAAAGGGCAGAAAGCGATCCGGCCGACATA
TGATTTAGTATCTGCAGGTTACAACATGATGAATAGTCTTAACGTACTAAGTTCAGAAACTGTGAGTGGT
GCCAGTTGTAACGGTGGTGCCTGCAGTAAGTTCAGTAATGCTGAAGAAGCTGCACAAGCTGTGGTGAGAG
TTCTTGGTGATCGCTCAATGCGCACCTGTAGCAATGCGTTGCAGTGTACCAGTGGCGATACCGACGATCA
GCCCGGCCTGTCCGTCGCTGGCACCGGATTTGCGCCGATGCTGGAAGAAGCCACAAAGAACAATACGGAG
CAACTGGTGAAACTGGTCAATGGTACCGTAAAACCCACAGCTACTGAACTGGCGAAACTGAAAACGGGTG
GGTTGCCGGTAACGGCCAATGTCATTAGGGCTCTGCAACGAGATCCGGATAATACTGCGCTGACCGTTCG
TCTTGCCAGTGAGCTTGCCATGTCTGATGCGGTCGAAACTGCACTATTGATGCGTCGGATGCTGACAACA
GGTATGAGTGAGCCAAATGCCCAGGATCAACCGCTCGCGCTGGAAGATGGTGTTCACCGGATCGATGCTC
TCGATCGCGAAATTATGGCATTGAAGAATGAAATGGACCTGAAGCGTGAGCTGGCGAGGAACTCGGTACT
GACCATCATTGAACGGGACAACGAACGTGTCGGTACAAACCCAATGATTCAGCAGACGGACAATGCCGAC
AGCCGGTTCCAGAAGCTCGATACCCCTGATGCAGAGTAA
 Primer design