SecReT4
Protein ID: 239820489
T4SS name [ID]VirB [418]
Gene symbol-
Locus tagVapar_5819
StrainVariovorax paradoxus S110
Repliconchromosome 2 [GenBank: NC_012792] [Browse all T4SS(s) in this replicon]
Location [Strand]524786..525508 [+]
ProductVirB8 family protein
Component typeVirB8
UniProt IDC5D064
KEGG IDvap:Vapar_5819
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.1e-53, Aligned region: 13..226
Protein Sequence: 240 a.a.     [Download]
>gi|239820489|ref|YP_002947674.1| VirB8 family protein [Variovorax paradoxus S110]
MSRDGSLENYLREAQNWELDRARRAERSTGIAWAVATSAALIAILAVAAVSGLTPLKQPVPVLIRVDSSS
GIVDIVPTYEGTTDIEQVVTRNLLQNYVIARERYFYGTAEADYELVASQNSPRLNQEWAALWAADNPASP
LNVYKDGTSIRAQVQSVTFLKLESGKDKLAQVRFTRSTRAGGTGEEQTSHWVSTIEFAYVPPSADNKVRS
LNPLGFRVVEYRREPEVAPASVAPVRQDAR
 
Nucleotide Sequence: 723 bp     [Download]
>gi|239819985|ref|NC_012792.1|:524786-525508 Variovorax paradoxus S110 chromosome 2, complete genome
ATGAGTCGGGACGGCTCCCTTGAGAACTACCTGCGCGAAGCCCAGAACTGGGAACTCGACCGCGCGCGTC
GGGCGGAGCGATCGACCGGGATCGCCTGGGCCGTGGCCACATCGGCAGCACTGATCGCGATCCTCGCCGT
CGCCGCCGTCAGCGGGCTCACGCCGCTGAAGCAGCCGGTTCCCGTTCTCATTCGGGTCGACAGCAGCAGC
GGCATCGTCGACATCGTCCCCACCTACGAAGGCACGACCGACATTGAGCAGGTCGTGACACGGAACCTGC
TGCAGAACTACGTGATTGCGCGCGAGCGTTATTTCTACGGCACCGCGGAAGCGGACTACGAACTGGTCGC
CTCGCAAAACTCGCCTCGTCTCAACCAGGAGTGGGCGGCCTTGTGGGCGGCCGACAACCCGGCCTCACCT
CTGAATGTCTACAAAGACGGCACTTCCATCCGCGCGCAGGTGCAATCGGTCACCTTCCTCAAGCTGGAGA
GCGGAAAGGACAAGCTGGCACAGGTCCGCTTCACCCGTTCGACGCGCGCAGGCGGCACCGGGGAGGAGCA
GACCAGCCACTGGGTCTCCACGATCGAGTTCGCCTATGTTCCGCCATCGGCGGACAACAAGGTGCGTTCG
CTCAACCCGCTGGGCTTTCGCGTCGTCGAATACCGCCGCGAGCCCGAGGTCGCGCCAGCTAGCGTTGCAC
CCGTCAGGCAGGATGCACGATGA
 Primer design