SecReT4
Protein ID: 239820492
T4SS name [ID]VirB [418]
Gene symbol-
Locus tagVapar_5822
StrainVariovorax paradoxus S110
Repliconchromosome 2 [GenBank: NC_012792] [Browse all T4SS(s) in this replicon]
Location [Strand]527650..528798 [+]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDC5D067
KEGG IDvap:Vapar_5822
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1e-65, Aligned region: 46..357
Protein Sequence: 382 a.a.     [Download]
>gi|239820492|ref|YP_002947677.1| P-type DNA transfer ATPase VirB11 [Variovorax paradoxus S110]
MRFEPNRPSLDGEPGATTGDRQPARARAHDGASAEPPSSLALFLGPLGHLLGDPAVTEICINEPGAAFVE
RQSGWTCETLPFASFDWCMSIAKLVANFTRQRISANEPLLSATLPGGERIQIVLPPATLDQTVSITIRRP
SNTLWTLEELEKLHIFETTRSAPPTPACQSERASLSPEDRELTDLLARRQFVPFLRCAVQFRKNILLSGA
TGSGKTTVGKALILEVPSEDRLITIEDVKELSLRNQPNHVRLFYSQGAQGQAEVTPGQLLAGAKRQRPDR
VFVSELRTGEEVYDYLVSVNTGHPGSITSVHADSAEMAFVALAQLMKRSQAGHGMTTRDGVELAQMSVDI
VVQCARERRDGLLRRSVREIWYDPGTKIRRLA
 
Nucleotide Sequence: 1149 bp     [Download]
>gi|239819985|ref|NC_012792.1|:527650-528798 Variovorax paradoxus S110 chromosome 2, complete genome
ATGCGCTTCGAACCGAACCGGCCATCCCTTGATGGCGAGCCCGGCGCCACCACAGGCGACCGGCAGCCGG
CGCGGGCGCGCGCGCATGACGGAGCCTCCGCAGAGCCGCCGTCGTCGCTTGCCCTCTTTCTCGGTCCGCT
CGGCCACTTATTGGGTGATCCCGCGGTGACCGAGATCTGCATCAACGAGCCCGGTGCAGCCTTCGTGGAA
CGGCAGTCCGGCTGGACGTGCGAGACGTTGCCGTTCGCGAGCTTCGACTGGTGCATGTCGATCGCGAAGC
TCGTGGCCAATTTCACGCGACAGCGCATCTCGGCCAACGAGCCACTCCTGTCCGCCACCCTCCCGGGCGG
CGAAAGAATCCAGATCGTGCTGCCACCCGCGACCCTGGACCAGACCGTCTCGATCACGATCCGGCGCCCC
TCGAACACGCTCTGGACCCTCGAAGAGCTGGAGAAATTGCACATCTTCGAGACCACGCGCAGTGCTCCCC
CGACTCCGGCGTGCCAATCTGAACGGGCGTCCCTGTCACCCGAAGACAGGGAGCTGACAGATCTCCTCGC
ACGCCGGCAATTCGTGCCCTTCCTGCGATGCGCCGTCCAGTTTCGCAAGAACATCCTACTGTCCGGCGCC
ACCGGCTCCGGCAAGACCACAGTCGGCAAGGCGCTGATCCTCGAGGTGCCGTCCGAGGACCGCCTGATCA
CCATCGAGGACGTGAAGGAGCTGTCGCTGCGCAACCAGCCCAACCACGTGAGACTCTTCTATTCGCAAGG
CGCCCAGGGGCAGGCCGAGGTCACGCCCGGCCAACTGCTCGCCGGCGCCAAGCGGCAACGTCCCGACCGG
GTGTTCGTGTCCGAGCTTCGCACCGGCGAAGAGGTCTACGACTATCTGGTGTCCGTGAACACCGGCCACC
CAGGCTCGATCACCAGCGTGCACGCCGACAGCGCGGAGATGGCCTTCGTGGCGCTGGCGCAGCTGATGAA
GCGCAGTCAGGCGGGCCACGGCATGACCACACGCGACGGCGTGGAACTGGCGCAGATGAGCGTGGACATC
GTCGTGCAGTGTGCGCGAGAGCGCCGGGACGGCCTGCTGCGGCGTAGCGTGCGGGAGATCTGGTATGACC
CTGGCACCAAGATACGAAGGCTTGCCTAG
 Primer design