SecReT4
Protein ID: 239820493
T4SS name [ID]VirB [418]
Gene symbol-
Locus tagVapar_5823
StrainVariovorax paradoxus S110
Repliconchromosome 2 [GenBank: NC_012792] [Browse all T4SS(s) in this replicon]
Location [Strand]528764..530719 [+]
ProductTRAG family protein
Component typeVirD4
UniProt IDC5D068
KEGG IDvap:Vapar_5823
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.2e-104, Aligned region: 101..544
TrwB_AAD_bind [PF10412], Evalue: 8.4e-28, Aligned region: 160..528
TraG-D_C [PF12696], Evalue: 2.5e-25, Aligned region: 393..513
Protein Sequence: 651 a.a.     [Download]
>gi|239820493|ref|YP_002947678.1| TRAG family protein [Variovorax paradoxus S110]
MTLAPRYEGLPSPFRIAVALLIAALVGMYVAGQAFLFAMNLPPQHATLLTLHEYWQAYGERPDVRRVLIA
SLVGSQGLMLGLVGIAMLPRRRPLHGNARFASRREIARSGLLNEHGIILGRLGNRYLVLPGQQGVALEAP
PRSGKGVGVVIPNLLNWPGSAIISDIKGENFMRTAGFRAAHGQQVHLFDPLSERERSARWNPLGYVSETP
YRCIDDLQRIGTMLFPDPQAGDPFWTSSARSLFLGIALYLFETKGATRTLGEILRQGMASDAEGFQKHWK
RVIDACERAGYPLSQEAVQSLYDVIDLAPTTASSIRKTFTSRLDLWLNPMIDATTSANDFDLRALRKHPI
SIYVQINPDNIARLQPLLNLFFQQAIGLQTRELPENNPELRHQVLLMLDEFPALGRIPVIADSTAFLPGY
NVRAVIIVQSNSQLIEKYGIEGAKSIRKMLAARIVFPPKEYEDAEAISRELGTYTVRQKNISRPMWGGAN
KEPTVTISEQPRRLLLPQEVKELGPDRMILFYEGLRPVLAHRILYFRDRLFAPRELPPPLVPKLNVDKPG
GAATTVPAAMLDDRKDTSGTGPGSLSNATPPDGGAAPTARQAAAVASNVLNDDLKLDDFSFDFDDVEIPT
EKLSDEDLKRHADEFMARILD
 
Nucleotide Sequence: 1956 bp     [Download]
>gi|239819985|ref|NC_012792.1|:528764-530719 Variovorax paradoxus S110 chromosome 2, complete genome
ATGACCCTGGCACCAAGATACGAAGGCTTGCCTAGTCCCTTCAGAATCGCGGTCGCGCTGCTGATCGCGG
CGCTGGTCGGCATGTACGTCGCCGGCCAAGCGTTCCTGTTCGCGATGAATCTGCCGCCACAGCACGCCAC
GCTGCTGACCCTTCACGAGTACTGGCAGGCCTACGGCGAGCGGCCGGACGTGCGCCGTGTCCTCATTGCG
TCGCTGGTCGGCTCCCAGGGGCTGATGCTCGGTCTGGTCGGAATTGCCATGCTGCCCCGCCGCCGGCCGC
TGCATGGAAATGCCCGGTTTGCGAGCCGTCGCGAGATCGCGCGATCGGGCCTCCTGAACGAGCACGGCAT
CATCCTCGGGCGGCTCGGCAATCGCTACCTGGTGCTTCCCGGCCAGCAGGGCGTCGCACTCGAGGCACCG
CCGCGCAGTGGCAAGGGCGTCGGCGTGGTCATCCCCAATCTGCTGAACTGGCCCGGCTCGGCCATCATCA
GCGACATCAAGGGCGAGAACTTCATGCGCACCGCCGGCTTCCGTGCGGCCCATGGGCAGCAGGTGCACCT
GTTCGATCCCCTGTCCGAGCGCGAGCGCTCGGCTCGCTGGAATCCGCTCGGCTATGTCTCCGAGACGCCC
TACCGCTGCATCGACGATCTGCAGCGCATCGGCACGATGCTCTTTCCCGATCCACAGGCCGGCGATCCCT
TCTGGACCTCCTCGGCCCGATCTCTATTCCTGGGCATTGCCCTCTATCTCTTCGAGACCAAAGGGGCCAC
GCGCACCTTGGGCGAGATCCTGCGCCAGGGCATGGCCAGCGATGCCGAGGGCTTTCAGAAACACTGGAAG
CGTGTCATTGATGCCTGCGAGCGCGCCGGGTATCCCTTGTCGCAGGAAGCGGTGCAGAGCCTCTACGACG
TGATCGACTTGGCACCGACCACGGCCTCCAGCATCCGCAAGACCTTCACCAGCCGCCTGGACCTGTGGCT
CAACCCGATGATCGATGCGACCACCTCGGCCAACGATTTCGACCTGAGGGCACTGCGCAAGCATCCGATC
TCGATCTATGTCCAGATCAACCCCGACAACATCGCCCGGCTGCAGCCGCTGCTGAACCTGTTCTTCCAGC
AGGCGATCGGCCTGCAAACGCGGGAACTCCCCGAGAACAATCCCGAGCTTCGCCACCAGGTGCTCCTGAT
GCTCGACGAATTTCCGGCGCTCGGGCGCATTCCCGTCATCGCCGACTCCACGGCCTTCCTGCCCGGCTAC
AACGTGCGCGCCGTAATCATCGTCCAGTCCAATTCGCAACTGATCGAGAAGTACGGTATCGAGGGCGCCA
AGTCGATCCGCAAGATGCTCGCGGCGCGCATCGTGTTCCCACCCAAGGAGTACGAGGACGCCGAGGCCAT
CTCGCGAGAGCTGGGGACCTACACCGTCCGACAGAAGAACATCAGCCGCCCGATGTGGGGCGGTGCGAAC
AAGGAGCCCACCGTGACCATCAGCGAGCAGCCGCGCCGCCTGCTGCTGCCCCAGGAGGTCAAGGAACTGG
GACCGGACCGGATGATCCTGTTCTACGAAGGCCTGCGGCCGGTGCTGGCGCATCGGATCCTCTACTTTCG
CGACAGGTTATTTGCCCCACGCGAACTGCCGCCACCACTGGTGCCGAAGCTGAACGTCGATAAGCCCGGC
GGCGCCGCCACAACCGTGCCGGCGGCAATGCTCGATGACAGGAAAGACACGTCCGGCACAGGTCCCGGAT
CCCTCTCCAACGCCACGCCTCCGGACGGTGGCGCCGCGCCGACGGCCCGGCAGGCCGCTGCCGTAGCCAG
CAATGTATTGAACGACGACTTGAAGTTGGACGACTTCTCGTTCGACTTCGACGACGTGGAGATTCCCACG
GAGAAGCTCAGCGACGAGGACCTGAAGCGCCACGCCGATGAGTTCATGGCGCGAATCCTGGACTGA
 Primer design