SecReT4
Protein ID: 240850962
T4SS name [ID]VirB [227]
Gene symbolvirB7
Locus tagBgr_14860
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]1674849..1675151 [+]
ProductVirB7 protein
Component typeVirB7
UniProt IDC6AER8
KEGG IDbgr:Bgr_14860
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 100 a.a.     [Download]
>gi|240850962|ref|YP_002972362.1| VirB7 protein [Bartonella grahamii as4aup]
MKRKITFVMVLTIALTGCASLSGPKKPPRCNGKHTRALNKDKWNWDNQNVVHPEKSVRTVTTPIILNTLE
SEKATANSALLKPVIHEARSDKTVEVTREK
 
Nucleotide Sequence: 303 bp     [Download]
>gi|240849682|ref|NC_012846.1|:1674849-1675151 Bartonella grahamii as4aup, complete genome
ATGAAACGAAAAATAACTTTTGTTATGGTCCTAACAATCGCTCTTACTGGTTGCGCCTCTTTGAGTGGCC
CCAAAAAACCACCACGCTGTAATGGCAAACATACACGTGCTTTAAATAAAGATAAGTGGAATTGGGACAA
TCAAAACGTTGTCCACCCAGAAAAGAGCGTAAGGACTGTTACCACTCCTATCATTCTCAATACTTTGGAA
AGTGAAAAAGCAACAGCCAATTCAGCTTTATTAAAGCCGGTTATTCATGAAGCACGATCTGATAAAACTG
TGGAGGTTACGCGTGAAAAGTGA
 Primer design