SecReT4
Protein ID: 240850963
T4SS name [ID]VirB [227]
Gene symbolvirB8
Locus tagBgr_14870
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]1675141..1675809 [+]
ProductVirB8 protein
Component typeVirB8
UniProt IDC6AER9
KEGG IDbgr:Bgr_14870
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.6e-61, Aligned region: 12..219
Protein Sequence: 222 a.a.     [Download]
>gi|240850963|ref|YP_002972363.1| VirB8 protein [Bartonella grahamii as4aup]
MKSDALEEYIKEARSFDIDRMHSMRVRMKISMALTVLFGLMTIALALAVAALTPLKTVEPFVIRVDNSTG
IIDTVSALKESPNDYDEAITRYFASQYVRAREGFQASEAENNFRLVSLLSSPKEQNRFGKWYAGNNPESP
QNIYHNMIATVTIKSISFISKDLIQVRYYKTVRDFNEKENISHWISILNFSYVNAHISTSDRLINPLGFQ
VSEYRSDPEVIK
 
Nucleotide Sequence: 669 bp     [Download]
>gi|240849682|ref|NC_012846.1|:1675141-1675809 Bartonella grahamii as4aup, complete genome
GTGAAAAGTGATGCCCTTGAAGAATATATAAAAGAAGCGCGCTCATTTGACATTGATCGCATGCATAGCA
TGCGCGTGCGAATGAAAATTTCCATGGCTTTAACAGTGCTTTTTGGATTGATGACGATTGCGCTGGCTTT
AGCTGTCGCAGCTTTGACGCCTTTAAAAACGGTAGAGCCTTTTGTTATCCGCGTCGATAACTCAACAGGC
ATTATTGATACTGTAAGCGCCCTCAAAGAATCCCCTAACGACTATGATGAAGCGATAACGCGTTATTTTG
CCAGCCAATATGTTCGTGCCCGTGAAGGTTTTCAAGCATCCGAAGCAGAAAACAATTTTCGCTTAGTTTC
TCTTTTATCTTCTCCAAAAGAACAAAACCGTTTTGGAAAATGGTACGCGGGCAATAATCCAGAAAGTCCG
CAAAATATTTATCATAACATGATTGCTACCGTCACAATCAAATCAATCTCTTTTATAAGCAAAGATCTTA
TCCAAGTTCGTTACTATAAAACGGTCAGAGACTTTAATGAAAAAGAAAATATTTCCCATTGGATTTCAAT
CTTAAATTTTTCCTACGTGAACGCACACATTTCAACGTCTGATCGTCTCATCAACCCTCTTGGTTTTCAA
GTATCGGAATATAGATCTGATCCAGAGGTGATAAAATGA
 Primer design