SecReT4
Protein ID: 240850966
T4SS name [ID]VirB [227]
Gene symbolvirB11
Locus tagBgr_14900
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]1677822..1678892 [+]
ProductVirB11 protein
Component typeVirB11
UniProt IDC6AES2
KEGG IDbgr:Bgr_14900
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.9e-94, Aligned region: 20..333
Protein Sequence: 356 a.a.     [Download]
>gi|240850966|ref|YP_002972366.1| VirB11 protein [Bartonella grahamii as4aup]
MNSNLHTMSDETIAIVLTKLEPIRAFLKDESLFEIVINRPYQVMTEGIDGWKTIEAPALSFNELMGIAKV
VASYSKQNISDKNPILSATLPGNERIQVVIPPAVEKNTISMTIRKPSSQSFSLEELANKGLFSLCEQISF
TPLNDYLSRFNELKIIEHNLAHAYCNKDFVSFLNQAVKCQKNILIAGKTGSGKTTLSKALIAKIPQEERI
ITIEDTQELVIPHPNHVSMFYSKDGQGLASVGPKELLESSLRMRPDRILLQELRDGTAFYYIRNVNSGHP
GSITTVHASTALAAFEQMTLLVKESDGGGDLERDDIRGLLISMIDIIIQCKRVEGKFKVTEIYYDPFKQR
NIFGGD
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|240849682|ref|NC_012846.1|:1677822-1678892 Bartonella grahamii as4aup, complete genome
ATGAACTCAAACTTACATACCATGAGCGATGAAACCATCGCGATTGTTCTCACAAAACTTGAACCCATCC
GTGCTTTTTTGAAAGATGAAAGTCTTTTTGAAATTGTTATCAATCGTCCCTACCAAGTAATGACGGAAGG
TATTGATGGATGGAAAACTATAGAAGCACCGGCTCTCTCTTTTAATGAGCTTATGGGGATTGCAAAAGTT
GTCGCGTCCTATTCCAAGCAAAACATATCAGACAAGAATCCAATATTATCGGCTACTCTGCCAGGTAATG
AGCGCATTCAAGTTGTTATTCCGCCGGCTGTCGAAAAAAACACGATTAGTATGACAATTCGCAAACCATC
ATCGCAAAGTTTTTCTCTCGAAGAGCTCGCGAATAAAGGTCTGTTTTCGCTCTGTGAACAGATATCTTTC
ACGCCATTAAATGATTATCTTTCTCGTTTTAACGAACTCAAAATCATCGAGCATAACTTAGCTCATGCCT
ACTGCAATAAAGACTTTGTCTCCTTTTTAAATCAAGCTGTAAAATGCCAGAAAAATATTTTAATTGCAGG
AAAAACTGGTTCGGGTAAAACAACATTATCAAAAGCATTAATCGCCAAAATTCCTCAAGAAGAGCGTATT
ATTACCATTGAAGATACACAAGAATTGGTGATACCGCACCCTAATCATGTCTCGATGTTCTATTCAAAAG
ATGGACAAGGCTTAGCCTCTGTTGGACCCAAAGAGTTGCTTGAATCATCTTTACGAATGCGTCCTGATCG
TATTCTTTTGCAAGAACTTCGAGATGGTACAGCCTTTTATTATATCCGCAATGTCAATTCAGGTCATCCA
GGTTCCATTACAACGGTTCATGCCTCAACAGCCCTTGCTGCCTTTGAGCAAATGACCCTTTTGGTCAAAG
AAAGTGACGGAGGAGGTGATTTAGAGCGTGATGATATTCGAGGACTGTTGATTTCAATGATTGATATCAT
CATCCAATGCAAACGGGTTGAAGGAAAGTTTAAGGTCACAGAAATTTATTATGATCCCTTCAAACAACGA
AACATCTTTGGAGGAGACTAA
 Primer design