SecReT4
Protein ID: 240850969
T4SS name [ID]VirB [227]
Gene symboltraG1
Locus tagBgr_14930
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]1680973..1682889 [+]
Productconjugal transfer coupling protein TraG
Component typeVirD4
UniProt IDC6AES5
KEGG IDbgr:Bgr_14930
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.3e-102, Aligned region: 158..636
TraG-D_C [PF12696], Evalue: 7.1e-29, Aligned region: 475..593
TrwB_AAD_bind [PF10412], Evalue: 1.6e-20, Aligned region: 318..609
Protein Sequence: 638 a.a.     [Download]
>gi|240850969|ref|YP_002972369.1| conjugal transfer protein TraG/VirD4 [Bartonella grahamii as4aup]
MKYTKTQMVLILTPIALGALTIFLVPHFLLFITNGLKSNQIYWTLRSEPLLVLALTAAVSLFYSLSQKLH
LRKGITFVSLIFFGTTALYYIGGEIKRLGPYVGQQGITWNYALQFMDPMVVFGIIIGVFFSIIQFITTSP
PKNKVKRAKKGVFGESAWMNLREAAKIFPANGQIVVGERYRVDEDNVCKIPFSPSNKTTWGKGGTAPLLT
FNLDFGSTHMIFFAGSGGYKTTSTVVPTCLTYPGSIICLDPSTEVAPMVKFARQKMGNRNVIVLDPNSFL
TKNFNVIDWLLDDSVPRTQREANIVSFSKLLLTDKKSDNSSAEYFSTQAHNLLTALLAHVIFSDEYKDSE
RNLKTLRGILSQSETAVVNQLRMIQETTPSPFIREMVGIFTEMAEQTFSGVYTTASKDTQWLSLSNYADL
VCGDDFFSSDITNGNTDVFLNLPASILNSYPAIGRVIIGAFLNAMVTADGNYKKRVLFVLDEVDLLGYMN
ILEEARDRGRKYGTSLMLFYQSSGQLVNHFGEAGARSWFESCSFVSYAAIKDFQTAKDISERCGQMTVEV
TGTSKSRGLSLGKSSYNVNYQQRALILPHEVIQEMRQDEQIILMQGQPPLRCGRAIYFRRKEMLAAAAKN
RFAPQKKN
 
Nucleotide Sequence: 1917 bp     [Download]
>gi|240849682|ref|NC_012846.1|:1680973-1682889 Bartonella grahamii as4aup, complete genome
ATGAAATATACCAAGACACAAATGGTACTCATTTTAACACCAATCGCTTTAGGTGCTTTAACGATATTCC
TTGTTCCTCATTTTTTGTTGTTTATAACAAATGGACTAAAGAGCAATCAAATTTATTGGACTCTTCGTTC
AGAACCTTTACTAGTCCTAGCACTAACAGCTGCTGTGTCATTGTTTTATAGTCTCTCGCAAAAGCTGCAC
TTACGTAAAGGAATTACTTTCGTTTCCCTTATCTTTTTTGGAACCACAGCTCTTTACTATATTGGTGGAG
AAATAAAACGTTTAGGTCCCTATGTTGGACAACAAGGAATAACGTGGAATTATGCGCTTCAATTCATGGA
CCCCATGGTTGTCTTTGGCATCATCATTGGTGTTTTTTTTTCCATTATTCAATTCATAACAACCTCTCCA
CCTAAAAATAAGGTCAAGCGTGCCAAAAAAGGTGTGTTTGGTGAATCCGCATGGATGAATTTAAGAGAGG
CAGCAAAAATTTTTCCTGCCAATGGACAAATTGTTGTGGGGGAAAGATACCGTGTTGATGAAGATAATGT
GTGCAAAATTCCCTTTTCACCTAGCAATAAAACAACATGGGGAAAGGGTGGGACAGCCCCTTTGCTAACC
TTTAATCTTGATTTTGGTTCAACTCATATGATCTTTTTTGCTGGTTCTGGTGGCTATAAAACCACAAGTA
CAGTAGTTCCCACGTGTTTAACCTATCCAGGGTCTATTATTTGTCTTGATCCTTCAACAGAAGTTGCCCC
AATGGTCAAATTTGCGCGTCAAAAGATGGGAAATAGAAATGTCATTGTTCTCGATCCCAATTCATTTTTA
ACAAAAAATTTCAATGTCATCGATTGGCTTTTAGACGATAGCGTACCACGCACACAACGCGAAGCAAATA
TTGTAAGCTTTTCTAAATTGCTTCTTACAGATAAAAAATCAGACAATTCTTCAGCGGAATATTTCTCGAC
ACAAGCTCATAACCTTTTAACAGCCCTTCTTGCTCATGTTATATTTTCTGATGAATATAAAGACAGCGAG
CGCAATTTAAAAACATTGCGTGGGATTCTCTCTCAATCAGAAACAGCTGTTGTCAATCAACTACGTATGA
TTCAAGAAACAACACCTTCTCCTTTTATTCGCGAAATGGTTGGTATTTTTACAGAAATGGCAGAGCAAAC
CTTTTCAGGAGTCTATACAACCGCATCAAAAGACACTCAATGGCTTTCTTTGTCCAATTACGCAGATCTT
GTCTGCGGAGATGATTTTTTTTCCTCAGATATTACAAATGGCAATACAGATGTTTTTCTCAATCTCCCCG
CAAGCATTTTAAACAGTTATCCAGCTATTGGACGCGTGATTATTGGTGCTTTTCTCAATGCCATGGTTAC
AGCAGACGGTAACTATAAAAAGCGTGTTTTATTTGTCTTAGATGAAGTTGATCTTCTAGGCTATATGAAT
ATTTTAGAAGAAGCGCGCGATCGTGGACGTAAATACGGTACATCCTTAATGCTTTTTTATCAATCCTCTG
GTCAGTTGGTCAATCACTTTGGAGAAGCTGGAGCACGTTCATGGTTTGAAAGCTGCTCCTTTGTCAGCTA
TGCTGCCATTAAAGACTTCCAAACTGCCAAAGACATTTCAGAACGCTGTGGCCAAATGACTGTTGAAGTA
ACCGGAACAAGCAAATCAAGAGGCTTATCTTTAGGAAAGAGTTCATACAACGTCAATTACCAACAAAGAG
CTCTGATTTTACCCCATGAAGTTATTCAAGAAATGCGTCAAGATGAACAAATTATTCTTATGCAAGGACA
ACCTCCTTTGCGATGTGGTCGCGCCATCTATTTCAGAAGAAAAGAAATGTTAGCCGCAGCTGCAAAAAAT
CGCTTTGCCCCACAAAAGAAAAACTAA
 Primer design