SecReT4
Protein ID: 240851205
T4SS name [ID]VirB [228]
Gene symbolvblB7
Locus tagBgr_18060
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2076909..2077193 [+]
ProductVblB7 protein
Component typeVirB7
UniProt IDC6AAH7
KEGG IDbgr:Bgr_18060
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 94 a.a.     [Download]
>gi|240851205|ref|YP_002972608.1| VblB7 protein [Bartonella grahamii as4aup]
MRKFKKIGIILPFLFLSGCMSSPNTLKSLPKCDGYSKRPLNRSMWNWEGKKPTPTPIIISNNTPSSVEGK
LETLLAQKLTDEEIKSYKNCGQKA
 
Nucleotide Sequence: 285 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2076909-2077193 Bartonella grahamii as4aup, complete genome
ATGCGGAAATTTAAAAAAATTGGGATTATCTTACCATTTCTCTTTCTCAGTGGCTGTATGTCTTCACCAA
ACACACTGAAGTCACTCCCAAAGTGTGATGGATATTCTAAACGTCCACTCAACAGATCAATGTGGAATTG
GGAAGGGAAAAAACCCACGCCCACACCAATCATTATCAGTAACAACACCCCTTCATCCGTAGAAGGTAAG
CTGGAAACGCTTCTGGCACAAAAATTAACGGATGAAGAAATCAAATCTTACAAAAATTGCGGGCAAAAAG
CATGA
 Primer design