SecReT4
Protein ID: 240851206
T4SS name [ID]VirB [228]
Gene symbolvblB8
Locus tagBgr_18070
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2077190..2077861 [+]
ProductVblB8 protein
Component typeVirB8
UniProt IDC6AAH8
KEGG IDbgr:Bgr_18070
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.1e-62, Aligned region: 12..220
Protein Sequence: 223 a.a.     [Download]
>gi|240851206|ref|YP_002972609.1| VblB8 protein [Bartonella grahamii as4aup]
MKEKDIEQYIAEARSFDQDRMLASRRTTRVSLAIAGIAVAVAIMSSLAVITLTPLKTVEPFVIRVDNSTG
IVEVVEALKEGPTNVDEAITRYFAAKYVRSREGFTTEETQHNFQTVSLLSSSEEQQRFASWYGARNPQSP
QILYKHAAVTITIKSISFINDDVAQVRYYRTIHDNDNNRDFITHWVATLTFEYINAPISVQNRLINPLGF
IVSEYRTDPEVVN
 
Nucleotide Sequence: 672 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2077190-2077861 Bartonella grahamii as4aup, complete genome
ATGAAAGAAAAAGACATAGAACAATACATTGCTGAAGCACGCTCGTTCGATCAAGATCGCATGCTCGCCT
CACGCCGCACCACCCGTGTCTCGCTTGCCATTGCCGGCATCGCGGTTGCTGTTGCAATAATGTCTTCTCT
CGCGGTCATCACCCTCACCCCCCTTAAAACCGTGGAACCTTTTGTCATCCGTGTGGACAATTCAACCGGC
ATTGTTGAAGTTGTGGAAGCCTTAAAAGAAGGTCCCACCAATGTCGACGAAGCAATCACACGCTACTTTG
CTGCAAAATATGTCCGCTCCCGTGAAGGCTTCACCACAGAAGAAACACAACACAATTTCCAAACCGTCTC
TCTCCTCTCTTCTTCTGAAGAACAGCAAAGATTTGCCAGCTGGTATGGAGCAAGAAATCCCCAAAGTCCT
CAAATTCTCTATAAACATGCCGCCGTTACAATAACAATAAAATCAATCTCCTTTATCAATGACGATGTTG
CCCAAGTGCGTTACTACAGAACCATCCATGACAACGACAACAACAGAGACTTCATCACCCACTGGGTTGC
AACACTTACCTTTGAATACATCAATGCCCCTATCTCTGTCCAAAACCGTTTGATAAACCCTCTAGGGTTT
ATTGTTAGTGAATATAGAACCGATCCGGAAGTGGTCAACTGA
 Primer design