SecReT4
Protein ID: 240851209
T4SS name [ID]VirB [228]
Gene symbolvblB11
Locus tagBgr_18100
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2079940..2080992 [+]
ProductVblB11 protein
Component typeVirB11
UniProt IDC6AAI1
KEGG IDbgr:Bgr_18100
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.9e-84, Aligned region: 18..330
DEAD [PF00270], Evalue: 6.7e-05, Aligned region: 174..230
Protein Sequence: 350 a.a.     [Download]
>gi|240851209|ref|YP_002972612.1| VblB11 protein [Bartonella grahamii as4aup]
MPSAKNAERASIVLTKLKILDDFLNNENLFEIVINRPGEVIVEGPDGWQTHILKELTYGELEGIAKVVAA
YTTQKISVENPVLSATLPNNERIQIVMPPAVAANTISMTIRKPSSRTFSLESLHENNLFSVAQNTSFTPT
QQMTERLSELSDTDKELTDLFIAKDFCTFLERAVITQQNILISGKTGSGKTTLSKALIAKIPEYERILTI
EDTPELVVPHSNKVQLFYSKDNQGLAKAGAKELLESGLRMRPDRILLQELRDGTAFYYIRNVNSGHPGSI
TTVHASTALAAFEQMTLLVKESDGGGNLARDDIRGLLISMIDVIIQCKRLEGKFRVTEIYYDPFKRRDAF
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2079940-2080992 Bartonella grahamii as4aup, complete genome
ATGCCATCAGCAAAAAATGCAGAACGCGCCTCTATCGTTTTAACAAAATTAAAGATCTTAGATGATTTCC
TCAATAATGAAAATTTATTTGAAATTGTTATCAATCGCCCCGGCGAAGTAATTGTTGAGGGTCCAGATGG
TTGGCAAACCCACATCTTAAAAGAACTAACCTACGGCGAACTAGAAGGAATTGCAAAAGTTGTTGCTGCC
TACACAACACAAAAAATCAGTGTAGAAAATCCCGTTCTCTCCGCAACACTGCCAAACAACGAACGCATAC
AAATTGTTATGCCTCCAGCTGTTGCAGCCAATACCATTAGCATGACCATTCGTAAACCTTCATCACGCAC
TTTTTCTCTTGAAAGTTTACATGAAAACAATCTGTTTTCTGTCGCCCAAAACACCAGTTTCACACCCACA
CAACAAATGACTGAACGGTTATCCGAACTCTCTGATACAGACAAAGAGTTAACAGATCTCTTTATCGCTA
AAGATTTTTGCACCTTTTTAGAAAGAGCCGTTATTACACAACAAAATATCTTAATATCGGGCAAAACCGG
TTCCGGGAAAACAACCCTCTCCAAAGCTTTAATTGCAAAAATCCCTGAATATGAACGAATTCTCACCATT
GAGGACACGCCAGAACTTGTCGTTCCCCATTCAAACAAAGTCCAACTCTTTTATTCAAAAGATAACCAGG
GCTTAGCAAAAGCAGGCGCAAAAGAACTACTTGAATCTGGCTTACGCATGCGCCCCGACAGAATCCTTCT
ACAAGAGCTGCGTGATGGTACAGCCTTTTACTATATCCGTAATGTCAACTCTGGTCACCCCGGCTCCATT
ACCACCGTCCATGCCTCAACAGCACTTGCAGCCTTCGAACAAATGACCCTTTTAGTCAAAGAAAGTGACG
GTGGTGGTAATTTAGCACGCGATGATATCCGCGGCTTATTAATCTCGATGATAGATGTCATCATCCAATG
TAAACGCCTCGAAGGAAAATTTCGTGTAACAGAAATCTATTACGATCCTTTCAAACGCCGTGATGCTTTT
TAA
 Primer design