SecReT4
Protein ID: 240851289
T4SS name [ID]Trw [146]
Gene symboltrwN
Locus tagBgr_19070
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2207642..2208274 [+]
ProductTrwN protein
Component typeTrwN
UniProt IDC6AAR1, B0RKB9
KEGG IDbgr:Bgr_19070
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 210 a.a.     [Download]
>gi|240851289|ref|YP_002972692.1| TrwN protein [Bartonella grahamii as4aup]
MIVPDFTFFAAAYISNTPPITFSVIAEQEARDSIYVTDDKDNFFYQSSQLKETIATTEQFGQSKHNFNII
LGQIGVGNVKLFSLFDAFGFCRNLTAVQSALTYCYEQTTSKCIFEKATLQSVLNFYNTENSNHTSIQKVT
SYIGVKAVVQENEDLQEPVKLKKEEPEQTTNVDSLPLFSKGEEDAFTHKESGTSDAFSVEDSSSSRGSLE
 
Nucleotide Sequence: 633 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2207642-2208274 Bartonella grahamii as4aup, complete genome
ATGATTGTTCCAGATTTCACATTTTTTGCTGCTGCGTACATATCCAATACACCTCCCATAACATTTTCAG
TTATCGCCGAACAAGAAGCGCGGGACAGTATCTATGTAACAGATGATAAAGATAACTTCTTCTATCAATC
ATCTCAGCTTAAGGAAACAATCGCAACAACTGAACAGTTTGGACAGAGCAAACATAATTTTAACATAATT
TTAGGGCAAATTGGTGTTGGAAATGTGAAATTGTTTTCTCTTTTTGATGCATTTGGTTTTTGTAGAAATC
TTACAGCTGTGCAAAGCGCTTTGACTTACTGCTATGAACAAACAACATCAAAGTGCATCTTTGAAAAAGC
GACTTTGCAATCTGTGCTAAATTTTTACAACACAGAAAACTCAAACCACACCTCTATACAGAAAGTTACT
TCATATATTGGAGTAAAAGCTGTCGTACAGGAAAATGAAGATTTGCAGGAGCCTGTAAAGCTTAAAAAAG
AAGAACCAGAACAGACAACTAACGTAGATTCTCTTCCTCTCTTTTCAAAGGGAGAAGAAGATGCATTTAC
ACATAAAGAAAGTGGTACCAGCGATGCTTTTTCGGTTGAAGATTCTTCTTCATCGAGAGGCTCGCTAGAG
TGA
 Primer design