SecReT4
Protein ID: 240851291
T4SS name [ID]Trw [146]
Gene symboltrwL1
Locus tagBgr_19090
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2208661..2208984 [+]
ProductTrwL1 protein
Component typeTrwL
UniProt IDC6AAR3, B0RKC1
KEGG IDbgr:Bgr_19090
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.4e-17, Aligned region: 7..101
Protein Sequence: 107 a.a.     [Download]
>gi|240851291|ref|YP_002972694.1| TrwL1 protein [Bartonella grahamii as4aup]
MKQLNILHTTARNKIALFSAALTVFFMGDSAHAQAQAAGLDPAKKALGLLQTDLKAIIPIAAAVILLCLA
IGYAGRYIGRDTFVRWAIGVVIAGSATELAELLFKNP
 
Nucleotide Sequence: 324 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2208661-2208984 Bartonella grahamii as4aup, complete genome
ATGAAACAATTAAATATTCTTCACACAACAGCTCGTAATAAAATTGCTTTATTTTCTGCAGCTTTAACCG
TATTTTTTATGGGTGATTCTGCTCATGCACAAGCCCAAGCAGCGGGTTTAGATCCTGCAAAAAAAGCTTT
AGGGCTGCTTCAAACAGATTTAAAAGCGATTATCCCTATCGCTGCTGCCGTTATACTTTTGTGCTTAGCA
ATTGGTTATGCAGGGCGCTATATCGGAAGAGATACATTCGTACGGTGGGCAATTGGTGTCGTTATCGCTG
GTTCAGCAACTGAACTTGCTGAGTTGTTATTTAAAAACCCCTGA
 Primer design