SecReT4
Protein ID: 240851292
T4SS name [ID]Trw [146]
Gene symboltrwL2
Locus tagBgr_19100
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2209125..2209439 [+]
ProductTrwL2 protein
Component typeTrwL
UniProt IDC6AAR4, B0RKC2
KEGG IDbgr:Bgr_19100
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3e-16, Aligned region: 6..100
Protein Sequence: 104 a.a.     [Download]
>gi|240851292|ref|YP_002972695.1| TrwL2 protein [Bartonella grahamii as4aup]
MKQLKTLQTIILNKATKTSAALTVFCMVNPVLAQAVVLDPANKALTALQTDLKVIIPIAAAVILLCLAIG
YAGRYIGKDTFVRWGIGVVVAGSAAELANLLFKS
 
Nucleotide Sequence: 315 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2209125-2209439 Bartonella grahamii as4aup, complete genome
ATGAAACAATTAAAAACTCTTCAAACAATAATTTTGAATAAAGCTACTAAAACCTCTGCAGCTTTAACTG
TATTTTGTATGGTCAATCCTGTGTTAGCCCAAGCAGTAGTTTTAGATCCTGCCAACAAAGCTTTAACTGC
TCTCCAAACAGACTTGAAAGTGATTATCCCTATTGCTGCTGCCGTGATACTTTTGTGCTTAGCAATTGGT
TATGCAGGACGCTACATTGGAAAAGACACATTTGTACGGTGGGGTATCGGTGTTGTTGTCGCTGGTTCAG
CAGCTGAACTTGCCAATTTGTTATTTAAAAGCTAG
 Primer design