SecReT4
Protein ID: 240851293
T4SS name [ID]Trw [146]
Gene symboltrwL3
Locus tagBgr_19110
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2209518..2209835 [+]
ProductTrwL3 protein
Component typeTrwL
UniProt IDB0RKC3, C6AAR5
KEGG IDbgr:Bgr_19110
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.8e-16, Aligned region: 6..100
Protein Sequence: 105 a.a.     [Download]
>gi|240851293|ref|YP_002972696.1| TrwL3 protein [Bartonella grahamii as4aup]
MKQLNIIQRIIRNKTIKSSAASAVFFMANPMLAQAVVLTPANNALTALQTDLKTLIPIAAAVILLCLAIG
YAGRYIGKDTFVRWGIGVVIAGSAAELANLLFKTT
 
Nucleotide Sequence: 318 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2209518-2209835 Bartonella grahamii as4aup, complete genome
ATGAAACAATTAAATATCATTCAGAGAATAATTCGTAATAAAACCATTAAAAGCTCTGCAGCTTCAGCTG
TCTTTTTTATGGCCAATCCTATGTTAGCCCAAGCAGTAGTTTTAACTCCTGCAAATAACGCTTTAACTGC
ACTCCAAACAGACTTAAAAACGCTTATCCCTATTGCTGCTGCCGTTATACTGTTGTGCTTAGCAATTGGC
TATGCAGGACGCTACATTGGAAAAGACACATTTGTACGGTGGGGTATCGGTGTTGTTATCGCAGGTTCAG
CAGCTGAACTTGCCAATTTATTATTTAAAACTACATAA
 Primer design