SecReT4
Protein ID: 240851294
T4SS name [ID]Trw [146]
Gene symboltrwL4
Locus tagBgr_19120
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2209960..2210280 [+]
ProductTrwL4 protein
Component typeTrwL
UniProt IDB0RKC4, C6AAR6
KEGG IDbgr:Bgr_19120
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.6e-19, Aligned region: 6..99
Protein Sequence: 106 a.a.     [Download]
>gi|240851294|ref|YP_002972697.1| TrwL4 protein [Bartonella grahamii as4aup]
MRKLTNFQKNNNQIITISAAITAFFISDPVYAQVKLTNAKTALDALQDDLVKNIIPVAAAVILLCLAIGY
AGRYIERDTFIRWAIGVVIAGSATQLAKLLFTGAVN
 
Nucleotide Sequence: 321 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2209960-2210280 Bartonella grahamii as4aup, complete genome
ATGAGAAAATTAACTAATTTCCAGAAAAATAATAATCAAATTATCACAATTTCTGCTGCTATAACTGCAT
TTTTTATTAGCGATCCTGTGTATGCTCAAGTAAAATTAACAAATGCAAAAACTGCTTTAGATGCTCTGCA
GGATGATCTTGTTAAAAATATTATTCCTGTTGCTGCTGCTGTTATACTTTTGTGCTTAGCAATTGGTTAC
GCAGGACGCTACATTGAAAGGGATACATTTATACGATGGGCAATCGGCGTTGTCATCGCTGGATCAGCAA
CCCAGCTTGCTAAGCTGTTATTCACAGGTGCAGTTAATTAA
 Primer design