SecReT4
Protein ID: 240851295
T4SS name [ID]Trw [146]
Gene symboltrwL5
Locus tagBgr_19130
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2210289..2210657 [+]
ProductTrwL5 protein
Component typeTrwL
UniProt IDB0RKC5, C6AAR7
KEGG IDbgr:Bgr_19130
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.4e-18, Aligned region: 22..116
Protein Sequence: 122 a.a.     [Download]
>gi|240851295|ref|YP_002972698.1| TrwL5 protein [Bartonella grahamii as4aup]
MKTIIQNVIYNLNERNMRKLINLQPKSNNKVAAISAAVVIFFMAHPVHSQAQALKAKDALTALQTDLTTH
IIPVAAAVILLCLAIGYAGRYIGRDTFVRWAIGVIVAGSATQLAKLLFTGQA
 
Nucleotide Sequence: 369 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2210289-2210657 Bartonella grahamii as4aup, complete genome
ATGAAAACTATAATACAAAATGTTATTTATAATCTTAATGAGAGAAATATGCGAAAATTAATTAACCTTC
AACCAAAAAGTAACAACAAAGTCGCAGCAATTTCTGCAGCTGTAGTTATATTTTTTATGGCTCATCCTGT
ACATTCCCAAGCGCAAGCTTTAAAAGCTAAAGATGCTTTAACAGCTCTACAAACGGATCTTACTACTCAT
ATTATTCCTGTTGCTGCTGCTGTTATACTTTTGTGCTTAGCAATTGGTTATGCAGGGCGCTATATCGGAA
GAGATACATTCGTACGATGGGCAATCGGTGTTATCGTCGCTGGCTCAGCAACCCAACTTGCTAAACTGCT
ATTCACGGGTCAAGCGTAA
 Primer design