SecReT4
Protein ID: 240851296
T4SS name [ID]Trw [146]
Gene symboltrwL6
Locus tagBgr_19140
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2210783..2211094 [+]
ProductTrwL6 protein
Component typeTrwL
UniProt IDC6AAR8, B0RKC6
KEGG IDbgr:Bgr_19140
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2e-17, Aligned region: 6..97
Protein Sequence: 103 a.a.     [Download]
>gi|240851296|ref|YP_002972699.1| TrwL6 protein [Bartonella grahamii as4aup]
MKKLINFQLKNNNRITAISAAISVFFIAHPANAKLKAEDALKALQTDLTTHIIPVAAAVILLCLAIGYAG
RYIGKDTFVRWAIGVIVAGSATQLASLLFKGQV
 
Nucleotide Sequence: 312 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2210783-2211094 Bartonella grahamii as4aup, complete genome
ATGAAAAAATTAATTAATTTCCAATTAAAAAATAACAACAGAATCACAGCAATTTCTGCAGCTATAAGTG
TATTTTTTATAGCACATCCTGCGAACGCAAAACTAAAAGCTGAAGATGCTTTAAAGGCTCTGCAAACAGA
TCTTACTACTCATATTATTCCTGTTGCAGCTGCTGTTATACTTTTGTGCTTAGCAATTGGTTACGCAGGC
CGCTACATCGGAAAAGATACATTTGTACGATGGGCAATCGGTGTTATCGTCGCTGGCTCAGCAACCCAAC
TTGCGAGTCTGTTATTCAAGGGTCAAGTGTGA
 Primer design