SecReT4
Protein ID: 240851297
T4SS name [ID]Trw [146]
Gene symboltrwL7
Locus tagBgr_19150
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2211209..2211529 [+]
ProductTrwL7 protein
Component typeTrwL
UniProt IDB0RKC7, C6AAR9
KEGG IDbgr:Bgr_19150
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.7e-18, Aligned region: 2..100
Protein Sequence: 106 a.a.     [Download]
>gi|240851297|ref|YP_002972700.1| TrwL7 protein [Bartonella grahamii as4aup]
MKKIINLKLKNNNKIIVISAAISAFFITQSAYANAKLGPAEKALNALQKDLIDNIIPVAAAVILLCLAIG
YAGRYIERDTFIRWAIGVVIAGSATQLAKLLFTGNA
 
Nucleotide Sequence: 321 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2211209-2211529 Bartonella grahamii as4aup, complete genome
ATGAAAAAAATAATTAATCTTAAATTAAAAAATAATAACAAAATTATTGTAATTTCTGCAGCTATAAGCG
CCTTTTTTATAACACAGTCTGCATATGCAAATGCAAAATTAGGTCCTGCTGAAAAAGCTCTAAATGCTCT
ACAAAAAGATCTTATTGATAACATTATTCCTGTTGCTGCTGCTGTTATACTTCTGTGCTTAGCAATTGGT
TACGCAGGACGATACATTGAAAGAGATACATTTATACGGTGGGCAATTGGTGTTGTCATCGCAGGTTCTG
CAACCCAACTTGCTAAACTGCTATTTACAGGTAATGCATAA
 Primer design