SecReT4
Protein ID: 240851298
T4SS name [ID]Trw [146]
Gene symboltrwL8
Locus tagBgr_19160
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2211655..2211963 [+]
ProductTrwL8 protein
Component typeTrwL
UniProt IDC6AAS0, B0RKC8
KEGG IDbgr:Bgr_19160
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 102 a.a.     [Download]
>gi|240851298|ref|YP_002972701.1| TrwL8 protein [Bartonella grahamii as4aup]
MKQLNTLQSKICKISAIFITSVMLLIIQSAYAQTETKSLDVFIGMQYGLSIIIPIVAAVILLLLLLIYIF
RIIARATFMRWAFSVIIAGAAFYISHILFHLH
 
Nucleotide Sequence: 309 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2211655-2211963 Bartonella grahamii as4aup, complete genome
ATGAAACAATTAAATACGCTTCAATCAAAAATATGTAAGATTAGTGCTATTTTTATCACTTCAGTTATGT
TATTAATAATTCAATCTGCATATGCTCAGACGGAAACAAAGAGTTTAGATGTTTTTATAGGAATGCAATA
TGGATTAAGTATAATTATTCCTATTGTTGCTGCTGTCATTCTTTTATTACTTTTGCTTATTTATATATTT
CGCATCATCGCAAGAGCTACATTTATGCGATGGGCCTTCAGTGTCATTATTGCTGGTGCAGCCTTTTATA
TTAGCCACATATTATTTCACCTCCACTGA
 Primer design