SecReT4
Protein ID: 240851301
T4SS name [ID]Trw [146]
Gene symboltrwJ1
Locus tagBgr_19190
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2214755..2215513 [+]
ProductTrwJ1 protein
Component typeTrwJ
UniProt IDB0RKD1, C6AAS3
KEGG IDbgr:Bgr_19190
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.3e-47, Aligned region: 67..232
Protein Sequence: 252 a.a.     [Download]
>gi|240851301|ref|YP_002972704.1| TrwJ1 protein [Bartonella grahamii as4aup]
MKKKLIPIVVVITLGISDPAMAWFFGAGAADLSATVPTTWPNFFGKSRETTPKEPPQQKEAPADPLLETL
KKQLEEVKKIQESITGNQKFDTKKLKNAQTDQSSFFLKNPETLYNRNKSSALTTSLKNILKEEEIPISVH
ESSSFINKRSQYAAITDKAVSLKTFEEANNRFQQIEELLNEIKTTKDLKSIAELQAHIIGMLAMLQNETA
KLQMVTHLRNAEYTLIKQQKDKHNIKILNSKNTKMPTIRFIR
 
Nucleotide Sequence: 759 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2214755-2215513 Bartonella grahamii as4aup, complete genome
ATGAAAAAAAAGCTCATTCCAATAGTAGTTGTAATAACTTTAGGGATTTCAGACCCAGCCATGGCTTGGT
TTTTTGGTGCTGGAGCGGCAGATTTGTCAGCAACAGTTCCAACGACGTGGCCCAATTTTTTTGGAAAGTC
ACGTGAAACAACGCCTAAAGAACCTCCACAACAAAAGGAAGCGCCAGCTGACCCACTTCTCGAAACACTA
AAAAAACAACTTGAGGAAGTAAAAAAGATACAGGAGTCTATAACGGGAAACCAAAAGTTCGACACTAAAA
AACTTAAAAATGCACAAACAGATCAGAGCAGTTTTTTTCTCAAAAATCCGGAGACGCTCTACAATAGAAA
TAAATCTTCTGCTCTAACTACATCACTTAAAAATATTTTAAAAGAAGAAGAAATTCCTATCTCTGTCCAT
GAATCTAGCAGTTTTATCAACAAGCGTAGCCAATATGCAGCCATCACTGATAAAGCCGTAAGTCTAAAGA
CTTTTGAAGAAGCAAATAATCGTTTTCAGCAAATTGAAGAACTATTAAACGAAATTAAGACAACAAAAGA
TCTAAAAAGTATTGCTGAGTTACAAGCACATATAATTGGAATGCTCGCTATGCTACAAAATGAAACAGCA
AAATTACAAATGGTCACACATTTACGCAATGCTGAATATACACTTATCAAACAGCAGAAGGACAAACATA
ACATAAAAATTTTGAATAGTAAAAACACGAAAATGCCTACCATAAGATTTATTAGATAA
 Primer design