SecReT4
Protein ID: 240851303
T4SS name [ID]Trw [146]
Gene symboltrwH1
Locus tagBgr_19210
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2216787..2216930 [+]
ProductTrwH1 protein
Component typeTrwH
UniProt IDB0RKD3, C6AAS5
KEGG IDbgr:Bgr_19210
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 47 a.a.     [Download]
>gi|240851303|ref|YP_002972706.1| TrwH1 protein [Bartonella grahamii as4aup]
MKSSTLIILITNLLSACALAPKLKQPNDRNRVPINKTIPAEIKRASI
 
Nucleotide Sequence: 144 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2216787-2216930 Bartonella grahamii as4aup, complete genome
ATGAAGTCGAGCACCCTTATAATTTTAATTACAAATCTTTTATCAGCTTGTGCATTAGCACCAAAGCTAA
AACAGCCCAATGATAGGAACCGTGTGCCTATTAATAAAACAATCCCTGCCGAAATCAAGCGAGCAAGTAT
ATGA
 Primer design